KEGG   Pseudomonas fluorescens SBW25: PFLU5007Help
Entry
PFLU5007          CDS       T00899                                 

Definition
protein disulfide isomerase II (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pfs  Pseudomonas fluorescens SBW25
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5502043..5502774)
Genome map
AA seq 243 aa AA seqDB search
MRLTQIIAAAAIALVSTFVVADDAAEQTIRKSLANLELDTPIESISASPMAGLYEVKLKG
SRVLYASADGQYIVQGYLFQLKDGKPVNLTEKAERLGVSKLINGIPVAETVVYPAIGETK
THITVFTDTTCPYCHKLHAEVPALNKLGVEVRYVAFPRQGLGSPGDEQLQAVWCSADKKA
AMDKMVDGKEIKAAKCANPVSKQFALGQSIGVNGTPAIVLADGQVIPGYQPAPQVAKLAL
SAK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgacccagattattgccgccgcagccattgcgttggtttccacctttgttgtc
gccgatgacgcggccgagcagaccattcgcaagagcctggccaacttggagctcgacacg
ccgatcgaaagcatcagcgccagcccgatggccggcctgtacgaagtcaagctcaagggc
agccgcgtgctgtacgccagtgccgacggccagtacatcgtgcagggctacctgttccag
ttgaaggacggcaagccggtcaacctgaccgagaaggccgagcgcctgggcgtgtccaag
ctgatcaacggcatcccggtggctgaaaccgtggtgtacccggccatcggcgagaccaag
acgcacatcaccgtgttcaccgacaccacctgcccgtactgccacaagcttcacgccgaa
gtgcctgcgctgaacaagctgggcgtggaagtacgctatgtagcgttcccgcgccagggc
ctgggttcgccgggtgacgagcagttgcaagccgtatggtgctcagccgacaagaaggcg
gccatggacaagatggtcgacggcaaggaaatcaaggcggccaaatgcgccaacccggtt
tccaagcagttcgccctgggccagtccattggcgtgaacggtacaccggccatcgttttg
gctgacggccaggtgattccgggctaccagccggcaccacaagttgccaaactggcgctg
agtgccaaataa

DBGET integrated database retrieval system