KEGG   Pseudomonas fluorescens SBW25: PFLU5117Help
Entry
PFLU5117          CDS       T00899                                 

Definition
putative cytochrome C
Orthology
K08738  
cytochrome c
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PFLU5117
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PFLU5117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5615476..5615850)
Genome map
AA seq 124 aa AA seqDB search
MKYALLSLVLLLNTHSAFAAGDAEAGGKLFAKTCGGCHSIGEGARGGFGPELNGIIGRPA
GTTADYQYSDAMKNSGVVWTRDKLAAYIEAPKKVVSGTRMIFWGISDQEKIENILAYLET
FQDK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacgcgttactctccctcgtcctgttactcaatacccactcggcgtttgctgcg
ggcgatgccgaggcgggcggcaagcttttcgccaagacctgcggcggttgccacagtatc
ggcgaaggcgcgcgcggcggctttggcccggaactcaacggcatcatcggacgccctgcg
gggacgaccgctgactatcagtactccgatgcgatgaagaactccggtgtggtctggacc
cgcgacaaactcgcggcctacatcgaggccccgaagaaagtggtgagtggcacgcggatg
attttctggggcatcagtgaccaggagaagatcgagaacatcctggcgtacctcgaaacg
ttccaggacaaataa

DBGET integrated database retrieval system