KEGG   Pseudomonas fluorescens SBW25: PFLU5158Help
Entry
PFLU5158          CDS       T00899                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pfs00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5656088..5656648
Genome map
AA seq 186 aa AA seqDB search
MTLSLPHHYREILKGLGEDPEREGLLDTPKRAAKAMQYLCHGYEQNLEEIVNGALFTSDN
DEMVILKDIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKLARIVDMFARRLQIQENLT
RQIADAIQDVTQAAGVAVVIEAKHMCMMMRGVEKQNSTMNTSVMLGAFRESNTTRMEFLQ
LIGRSK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaccttatccctgccccaccattaccgcgagatcctcaagggcttgggcgaagacccc
gagcgcgaaggcttgctcgacacccccaagcgcgccgccaaggccatgcaatacctgtgt
catggctatgagcagaacctggaagagatcgtcaacggcgcgctgtttacctctgacaat
gacgagatggtgatcctcaaggacatcgagctgtactcgctgtgcgagcaccacctgctg
ccctttatcggcaaggcccacgtggcctatattccgaccggcaaggtattgggcctgtcg
aaactggcgcgcatcgtcgatatgtttgcacgccgcctgcagatccaggaaaacctcacc
cggcaaattgccgacgctatccaggacgtgacccaggcagccggtgtggcggtggtaatc
gaagccaagcacatgtgcatgatgatgcgcggcgtggaaaaacagaattcaaccatgaac
acctcggtgatgctcggcgcgttccgcgagtcgaacaccacgcgcatggagttcctgcaa
ctgatcggacggagcaagtag

DBGET integrated database retrieval system