KEGG   Pseudomonas fluorescens SBW25: PFLU5158Help
Entry
PFLU5158          CDS       T00899                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PFLU5158
Enzymes [BR:pfs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PFLU5158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5656088..5656648
Genome map
AA seq 186 aa AA seqDB search
MTLSLPHHYREILKGLGEDPEREGLLDTPKRAAKAMQYLCHGYEQNLEEIVNGALFTSDN
DEMVILKDIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKLARIVDMFARRLQIQENLT
RQIADAIQDVTQAAGVAVVIEAKHMCMMMRGVEKQNSTMNTSVMLGAFRESNTTRMEFLQ
LIGRSK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaccttatccctgccccaccattaccgcgagatcctcaagggcttgggcgaagacccc
gagcgcgaaggcttgctcgacacccccaagcgcgccgccaaggccatgcaatacctgtgt
catggctatgagcagaacctggaagagatcgtcaacggcgcgctgtttacctctgacaat
gacgagatggtgatcctcaaggacatcgagctgtactcgctgtgcgagcaccacctgctg
ccctttatcggcaaggcccacgtggcctatattccgaccggcaaggtattgggcctgtcg
aaactggcgcgcatcgtcgatatgtttgcacgccgcctgcagatccaggaaaacctcacc
cggcaaattgccgacgctatccaggacgtgacccaggcagccggtgtggcggtggtaatc
gaagccaagcacatgtgcatgatgatgcgcggcgtggaaaaacagaattcaaccatgaac
acctcggtgatgctcggcgcgttccgcgagtcgaacaccacgcgcatggagttcctgcaa
ctgatcggacggagcaagtag

DBGET integrated database retrieval system