KEGG   Pseudomonas fluorescens SBW25: PFLU5166Help
Entry
PFLU5166          CDS       T00899                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PFLU5166
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PFLU5166
Enzymes [BR:pfs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PFLU5166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5662383..5662952)
Genome map
AA seq 189 aa AA seqDB search
MQSASMIAGLRVVISKGRNAKNMGYLEFVMSAFHDLKLKALDGQELPLAPFKGQVVLVVN
VASKCGLTPQYAALENLYQQYKAQGFTVLGLPCNQFAGQEPGTEEEIQQFCSLNYGVTFP
LGSKLEVNGPDRHQLYRLLAGEGAEFPGDITWNFEKFLLGKDGRVLARFSPRTAPDDPTV
VQAIEKALA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatcggcgtctatgattgcaggcttgcgggttgtaatctcgaagggccgcaatgcg
aagaacatgggatatctggagttcgtcatgagtgctttccacgacctgaaactcaaagct
ttggacggacaagagctgccgctggcgcccttcaaggggcaagtggtgctggtggtcaac
gtagcctccaaatgtggtttgaccccgcaatacgctgcgctggaaaacctctaccagcag
tacaaggcccagggatttaccgtgctcggcctgccgtgcaatcaatttgcaggccaggag
ccgggtaccgaagaggagatccagcagttctgcagcctgaactacggggtgacgttcccg
ctgggcagcaagcttgaggtcaacggccccgatcgtcatcagctgtaccgcctgctggcg
ggcgaaggcgccgagtttcctggggatatcacctggaacttcgaaaaattcctgctgggc
aaggatgggcgagtgctcgcacgcttctccccgcgcaccgcgccggatgatcccacggtc
gtccaagccatcgagaaagccctggcctga

DBGET integrated database retrieval system