KEGG   Pseudomonas fluorescens SBW25: PFLU5240Help
Entry
PFLU5240          CDS       T00899                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PFLU5240
Enzymes [BR:pfs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PFLU5240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5748986..5749471
Genome map
AA seq 161 aa AA seqDB search
MGRIYIGMGSNLAAPDQQLRSAIEALAQLPGTTVAGVSAFYQSDSLLPGQPRYTNAVAAL
DSSLAPLELLDALQAIENDQGRERLERWGPRTLDLDILLFGDHLIDEPRLKVPHYQMHLR
AFVLYPLAELAPATLSLPDGQTLRDLLAACPFIGLERLPQD
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtgggacgcatctacatcggcatgggcagcaacctggctgccccggatcagcaattgcgc
agtgctattgaagcgctggcgcaattgccaggcaccaccgtcgccggtgtctccgccttt
tatcaaagtgactctctgctcccgggccagccgcgctataccaatgcggtggccgccctg
gacagcagcctcgcgccccttgagttactggatgcgctgcaagccatcgaaaacgaccag
ggccgcgaacgcctggagcgctggggaccgcgcacgctcgacctggatatcctgctgttt
ggcgatcacctgatcgacgagccacgcctcaaggtgccccattaccagatgcacctgcgt
gcgtttgtactgtacccgctggcggaactggcgcccgccaccctgtcattgcctgacggc
caaaccctgcgcgacttgctggccgcttgcccgtttatcggcctggaacgccttcctcag
gactga

DBGET integrated database retrieval system