KEGG   Pseudomonas fluorescens SBW25: PFLU5586Help
Entry
PFLU5586          CDS       T00899                                 

Definition
putative 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pfs00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6118805..6119323)
Genome map
AA seq 172 aa AA seqDB search
MSLTQVYLGLGSNIERESHLRAGLDALAVFLTDMRCSAVFESQPVGIKSGPFFNLVVSAY
TDLPLMELDRRLKFIEADNGRYAPDRKGLPLDIDVLLYGELVGNFEGLVLPRAEILKNAF
VLWPLSLMTPDRVHPEVGKTLAELWRDAQIDQVLAPVGFEWRGQQLTPGTLL
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctaactcaggtttaccttggcctaggcagtaatatcgagcgcgagtcccatcta
cgcgccggccttgatgcgttggcggtttttttgaccgatatgcgctgctcggcggtgttc
gaaagccagccggtgggcatcaagagcgggcctttcttcaacttggtggtgtcggcctat
accgacctgccgttgatggagctggatcgccggttgaaattcatcgaggccgataatggt
cgctatgcgccggaccgtaagggcttgccgctggatatcgacgtgctgctgtatggcgag
ctggtgggtaatttcgagggcctggtcctgccccgtgcagagatcctgaagaacgccttt
gtgctgtggccactgtcgttgatgacgcccgatcgcgtgcaccctgaggtgggcaagacc
ctggccgaactgtggcgcgatgcgcagattgaccaggtgttggcccctgtcgggtttgaa
tggcggggccagcaactcacgccaggcacgcttttgtag

DBGET integrated database retrieval system