KEGG   Pseudomonas fluorescens SBW25: PFLU5646Help
Entry
PFLU5646          CDS       T00899                                 

Gene name
fdhA
Definition
glutathione-independent formaldehyde dehydrogenase (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pfs01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:pfs00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:pfs00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6184971..6186170)
Genome map
AA seq 399 aa AA seqDB search
MSGNRGVVYLGNGKVEVQKIDYPKMQDPRGRKIEHGVILRVVSTNICGSDQHMVRGRTTA
QTGLVLGHEITGEVIEKGSDVENLKIGDLVSVPFNVACGRCRSCKEQHTGVCLTVNPARA
GGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPDRDKAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYIAGAGPVGLAAAASARLLGAAVVIIGDVNPIRLAHAKAQGFEIADLSQD
TPLHEQIAALLGEPEVDCAVDCVGFEARGHGHDGVKAEAPATVLNSLMGVVRVAGKIGIP
GLYVTEDPGAVDAAAKMGSLSIRFGLGWAKSHSFHTGQTPVMKYNRQLMQAIMWDRINIA
EIVGVQVISLDDAPRGYGEFDAGVPKKFVIDPHKLFSAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtaatcgtggtgtcgtgtatctcggcaacggcaaggtcgaagtacagaaaatc
gactatcccaaaatgcaggacccccgtggcaggaagattgagcacggcgtcatcctgcgc
gtggtctccaccaacatctgcggctccgaccaacacatggtgcgcggccgtaccactgcc
cagaccggcctggtgctcggtcatgaaattaccggtgaagtgatcgagaagggcagcgat
gtcgaaaacctgaagatcggtgatctggtttcggtacctttcaacgtggcgtgcggccgt
tgccgctcgtgcaaagaacaacacaccggcgtgtgcctcaccgtcaacccggcgcgtgcc
ggtggcgcctacggctatgtcgacatgggcgactggaccggcggccaggccgagtacgtg
ctggtgccgtacgccgacttcaacctgctgaaactgccagaccgtgacaaggccatggag
aaaatccgcgacctgacctgcctctccgacatcctcccgaccggttaccacggcgccgtc
actgccggcgttggccctggcagcaccgtgtacatcgccggtgccggccctgtgggcttg
gccgctgcggcttccgcccgcctgttgggtgctgccgtggtgatcatcggcgacgtcaac
cctatccgtctggctcacgccaaggcccagggctttgaaattgccgacctgtcccaagac
acgccgctgcacgaacagatcgccgcactgctcggcgagccggaagtggactgcgctgtt
gactgtgtgggctttgaagcacgcggccacggccatgacggcgtcaaggcagaggcaccg
gccacggtgctcaactcactgatgggcgtcgtgcgcgtggccggcaagattggcatcccc
ggcctgtacgtcaccgaagacccaggtgctgtggacgccgccgcgaaaatgggcagcctg
agcatccgtttcggcctgggctgggccaaatcccacagcttccacaccgggcagacaccg
gtgatgaagtacaaccgccagttgatgcaggcgatcatgtgggaccgtatcaacattgcc
gaaatcgtcggcgtgcaggtgatcagcctggatgatgccccgcgtgggtatggcgagttt
gatgcgggtgtaccgaagaagtttgtgattgacccgcacaaactcttcagcgcggcataa

DBGET integrated database retrieval system