KEGG   Pseudomonas fluorescens SBW25: PFLU5679Help
Entry
PFLU5679          CDS       T00899                                 

Gene name
sdaA
Definition
L-serine dehydratase 1 (EC:4.3.1.17)
Orthology
K01752  
L-serine dehydratase [EC:4.3.1.17]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:pfs01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pfs01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pfs00260]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pfs00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6223161..6224537)
Genome map
AA seq 458 aa AA seqDB search
MAISVFDLFKIGIGPSSSHTVGPMRAAALFVQALRERELLEQVRRVEVQLYGSLSATGIG
HGSDTATIMGLMGEWPDAIDPAQIGLRIHTLRETDTLLLDGRLPVPFVWARDMRLLDENL
PFHPNAMTLVVYDDNGELHRDTYYSVGGGFVVDEAQAQSGVADMDRTELPYDFSSAVELL
QLCKTHNLRVAELMLANEKTWRSEEEIRSGLMKLWRAMQDCVEQGLKHEGILPGGLNVRR
RAAKLHRSLQELGKPNVIGSTLSAMEWVNLFALAVNEENAAGGRMVTAPTNGAAGIIPAV
LHYFMKFSEEVTEANVVDYLLGAAAVGILCKKNASISGAEVGCQGEVGSACAMAAAGLAE
ILGATPEQLCNAAEIGLEHNLGLTCDPVGGLVQVPCIERNAIAAVKAINAAQMALRGDGQ
HFISLDRVIRTMRDTGADMHDKYKETSRGGLAVSAVEC
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggctatcagcgttttcgacctgttcaagatcggcatcgggccttcgagttctcacacc
gtcggccccatgcgcgccgcggcgttgttcgttcaagcactgcgtgaacgtgaactgttg
gaacaggttcggcgcgttgaagttcagctctacggttccttgtcggccacgggcatcggc
cacggcagcgacacggccaccatcatgggcctgatgggcgagtggccggacgcgatcgat
ccggcgcaaatcggcctgcggatccacaccctgcgcgagaccgacaccctgctgctggac
ggacgcttgcccgtgccgttcgtgtgggcccgtgacatgcgcctgctggacgaaaacctg
cccttccaccccaacgccatgaccttggtggtgtacgacgataacggtgagttgcaccgc
gacacctactattcggtggggggcggctttgtggtggatgaggcccaggcgcaaagcggc
gtggccgatatggaccgcaccgagttgccctatgatttttccagcgcggtggagctgtta
cagctgtgtaagacccacaacctgcgcgtggccgaattgatgctggccaacgaaaaaacc
tggcgctcggaagaagaaatccgcagtggcctgatgaagctctggcgcgccatgcaggat
tgcgtggagcagggcctcaagcacgaaggcatcctgcccggcggcctgaacgtgcgccgc
cgcgccgccaagctgcaccgcagtttgcaggaattgggcaagccgaatgtgatcggctcg
accttgagcgcgatggaatgggtcaatctgttcgccctggcggtgaacgaggaaaacgcg
gccggtgggcgcatggtcacggcacccaccaacggtgcggcggggattattccggcggtg
ctgcattacttcatgaaattcagcgaggaggtgacggaagccaacgtggtcgactacctg
ctcggcgcggcggcggtcggcatcctgtgcaagaaaaacgcctcgatttccggcgccgaa
gtcggctgccaaggggaggtgggctcggcctgcgccatggctgccgccgggctggcggag
atccttggcgccacgccggagcaactgtgcaacgccgccgaaatcggcctggagcacaat
ctgggcctgacctgcgaccccgtgggtgggctggtgcaagtgccgtgcatcgagcgcaat
gccattgcagcggtgaaggcgatcaatgcggcgcaaatggctttgcgtggcgacggccag
cactttatttccctggatcgggtgatccgcaccatgcgggataccggggcggatatgcat
gacaagtacaaagagacatcgcggggtgggctggcggtcagcgcagtagagtgttga

DBGET integrated database retrieval system