KEGG   Pseudomonas fluorescens SBW25: PFLU5679Help
Entry
PFLU5679          CDS       T00899                                 

Gene name
sdaA
Definition
L-serine dehydratase 1 (EC:4.3.1.17)
Orthology
K01752  
L-serine dehydratase [EC:4.3.1.17]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFLU5679 (sdaA)
   01230 Biosynthesis of amino acids
    PFLU5679 (sdaA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PFLU5679 (sdaA)
   00270 Cysteine and methionine metabolism
    PFLU5679 (sdaA)
Enzymes [BR:pfs01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     PFLU5679 (sdaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6223161..6224537)
Genome map
AA seq 458 aa AA seqDB search
MAISVFDLFKIGIGPSSSHTVGPMRAAALFVQALRERELLEQVRRVEVQLYGSLSATGIG
HGSDTATIMGLMGEWPDAIDPAQIGLRIHTLRETDTLLLDGRLPVPFVWARDMRLLDENL
PFHPNAMTLVVYDDNGELHRDTYYSVGGGFVVDEAQAQSGVADMDRTELPYDFSSAVELL
QLCKTHNLRVAELMLANEKTWRSEEEIRSGLMKLWRAMQDCVEQGLKHEGILPGGLNVRR
RAAKLHRSLQELGKPNVIGSTLSAMEWVNLFALAVNEENAAGGRMVTAPTNGAAGIIPAV
LHYFMKFSEEVTEANVVDYLLGAAAVGILCKKNASISGAEVGCQGEVGSACAMAAAGLAE
ILGATPEQLCNAAEIGLEHNLGLTCDPVGGLVQVPCIERNAIAAVKAINAAQMALRGDGQ
HFISLDRVIRTMRDTGADMHDKYKETSRGGLAVSAVEC
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggctatcagcgttttcgacctgttcaagatcggcatcgggccttcgagttctcacacc
gtcggccccatgcgcgccgcggcgttgttcgttcaagcactgcgtgaacgtgaactgttg
gaacaggttcggcgcgttgaagttcagctctacggttccttgtcggccacgggcatcggc
cacggcagcgacacggccaccatcatgggcctgatgggcgagtggccggacgcgatcgat
ccggcgcaaatcggcctgcggatccacaccctgcgcgagaccgacaccctgctgctggac
ggacgcttgcccgtgccgttcgtgtgggcccgtgacatgcgcctgctggacgaaaacctg
cccttccaccccaacgccatgaccttggtggtgtacgacgataacggtgagttgcaccgc
gacacctactattcggtggggggcggctttgtggtggatgaggcccaggcgcaaagcggc
gtggccgatatggaccgcaccgagttgccctatgatttttccagcgcggtggagctgtta
cagctgtgtaagacccacaacctgcgcgtggccgaattgatgctggccaacgaaaaaacc
tggcgctcggaagaagaaatccgcagtggcctgatgaagctctggcgcgccatgcaggat
tgcgtggagcagggcctcaagcacgaaggcatcctgcccggcggcctgaacgtgcgccgc
cgcgccgccaagctgcaccgcagtttgcaggaattgggcaagccgaatgtgatcggctcg
accttgagcgcgatggaatgggtcaatctgttcgccctggcggtgaacgaggaaaacgcg
gccggtgggcgcatggtcacggcacccaccaacggtgcggcggggattattccggcggtg
ctgcattacttcatgaaattcagcgaggaggtgacggaagccaacgtggtcgactacctg
ctcggcgcggcggcggtcggcatcctgtgcaagaaaaacgcctcgatttccggcgccgaa
gtcggctgccaaggggaggtgggctcggcctgcgccatggctgccgccgggctggcggag
atccttggcgccacgccggagcaactgtgcaacgccgccgaaatcggcctggagcacaat
ctgggcctgacctgcgaccccgtgggtgggctggtgcaagtgccgtgcatcgagcgcaat
gccattgcagcggtgaaggcgatcaatgcggcgcaaatggctttgcgtggcgacggccag
cactttatttccctggatcgggtgatccgcaccatgcgggataccggggcggatatgcat
gacaagtacaaagagacatcgcggggtgggctggcggtcagcgcagtagagtgttga

DBGET integrated database retrieval system