KEGG   Pseudomonas fluorescens SBW25: PFLU5986Help
Entry
PFLU5986          CDS       T00899                                 

Definition
putative phosphomannomutase/phosphoglucomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pfs00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pfs00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pfs00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pfs00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pfs00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pfs00520]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pfs00230]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:pfs00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6542328..6543725
Genome map
AA seq 465 aa AA seqDB search
MSTAARVAPTFPDSIFRAYDIRGVVPKTLTAETAYWIGRAIGSQSLAQDEPNVSVGRDGR
LSGPELVEQLIQGLADSGCHVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPSDYNGFK
IVIAGDTLANEQIQALHNRLKTNDLTSGKGTISKVDILQRYSDEITRDVKLERRLKVVVD
CGNGAAGVIAPQLLEALNCEVIPLFCEVDGNFPNHHPDPGKPENLVDLIAKVKETGADVG
LAFDGDGDRVGVVTETGEIVFPDRLLMLFARDVVARNPGAEIIFDVKCTRRLTPLIKEYG
GRPLMWKTGHSLIKKKMKETGALLAGEMSGHVFFKERWFGFDDGIYSAARLLEILSKEKS
TAEELFQTFPNDISTPEINIHVTEESKFSIIDALHDAQWGEGANLTTIDGVRVDYAKGWG
LVRASNTTPVLVLRFEADTEAELQRIKDVFHAQLKRVAPDLQLPF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgcagcccgagtagccccgacattccccgacagcatctttcgcgcctacgac
atccgtggcgtggtgcctaagacgctgactgccgaaaccgcctactggattggccgcgcc
atcggctcacagagcctggcccaggatgagcccaacgtgtcggtcggccgtgacggtcgc
ctgtccggcccggagttggtggaacaactgatccagggcctggccgacagcggttgccat
gtgagtgatgtcggcctggtgccgaccccagcgctgtactacgcagccaacgtactggcc
ggcaagtccggggtgatgctcaccggcagccataacccgtcggactacaacggtttcaag
atcgtcatcgctggcgacaccctggccaacgaacagatccaggccctacacaaccgcctg
aaaaccaacgacctgaccagcggtaagggcaccatcagtaaagtcgacatcttgcagcgc
tactctgacgaaatcacccgtgacgtcaaacttgagcgccgtctgaaagtggtggtggac
tgcggcaacggcgcggccggcgtgatcgccccgcagctgctcgaagccctgaactgcgaa
gtgatccccttgttctgcgaggtcgacggcaacttccccaaccaccacccggacccgggc
aagcctgaaaacctggttgacctgatcgccaaggtcaaggaaaccggggctgacgtcggc
ctggcctttgacggcgacggcgaccgcgtgggggtggtgactgaaaccggtgaaatcgta
ttcccggaccgcctgctgatgctgttcgcccgcgacgtggttgcacgtaacccaggcgcc
gagatcattttcgacgtgaagtgcacccgccgcctcacgccgctgatcaaggaatacggc
ggtcgcccgctaatgtggaagaccggtcactcgttgatcaaaaagaaaatgaaagaaacc
ggcgcgctgttggccggcgaaatgagtggtcacgtgttcttcaaggagcgctggttcggc
tttgacgacggcatttacagtgccgcacgcctgctggagatcctcagcaaggaaaaatcc
accgccgaagagctgttccagaccttcccgaacgatatttctacgccagagatcaatatc
catgtgaccgaggagagcaaattcagcatcattgacgcactgcacgatgcgcaatggggc
gaaggcgccaacctgaccaccattgatggtgtgcgagtcgattacgccaaaggctggggc
ctggttcgcgcgtccaacaccacaccggtgctggtcctgcgtttcgaggcggataccgag
gctgagttgcagcgcatcaaggacgtgttccacgcccagttgaaacgtgttgcccctgat
ctccaattaccgttctga

DBGET integrated database retrieval system