KEGG   Pseudomonas fluorescens SBW25: PFLU5986Help
Entry
PFLU5986          CDS       T00899                                 

Definition
putative phosphomannomutase/phosphoglucomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFLU5986
   00030 Pentose phosphate pathway
    PFLU5986
   00051 Fructose and mannose metabolism
    PFLU5986
   00052 Galactose metabolism
    PFLU5986
   00500 Starch and sucrose metabolism
    PFLU5986
   00520 Amino sugar and nucleotide sugar metabolism
    PFLU5986
  Nucleotide metabolism
   00230 Purine metabolism
    PFLU5986
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PFLU5986
Enzymes [BR:pfs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PFLU5986
    5.4.2.8  phosphomannomutase
     PFLU5986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6542328..6543725
Genome map
AA seq 465 aa AA seqDB search
MSTAARVAPTFPDSIFRAYDIRGVVPKTLTAETAYWIGRAIGSQSLAQDEPNVSVGRDGR
LSGPELVEQLIQGLADSGCHVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPSDYNGFK
IVIAGDTLANEQIQALHNRLKTNDLTSGKGTISKVDILQRYSDEITRDVKLERRLKVVVD
CGNGAAGVIAPQLLEALNCEVIPLFCEVDGNFPNHHPDPGKPENLVDLIAKVKETGADVG
LAFDGDGDRVGVVTETGEIVFPDRLLMLFARDVVARNPGAEIIFDVKCTRRLTPLIKEYG
GRPLMWKTGHSLIKKKMKETGALLAGEMSGHVFFKERWFGFDDGIYSAARLLEILSKEKS
TAEELFQTFPNDISTPEINIHVTEESKFSIIDALHDAQWGEGANLTTIDGVRVDYAKGWG
LVRASNTTPVLVLRFEADTEAELQRIKDVFHAQLKRVAPDLQLPF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgcagcccgagtagccccgacattccccgacagcatctttcgcgcctacgac
atccgtggcgtggtgcctaagacgctgactgccgaaaccgcctactggattggccgcgcc
atcggctcacagagcctggcccaggatgagcccaacgtgtcggtcggccgtgacggtcgc
ctgtccggcccggagttggtggaacaactgatccagggcctggccgacagcggttgccat
gtgagtgatgtcggcctggtgccgaccccagcgctgtactacgcagccaacgtactggcc
ggcaagtccggggtgatgctcaccggcagccataacccgtcggactacaacggtttcaag
atcgtcatcgctggcgacaccctggccaacgaacagatccaggccctacacaaccgcctg
aaaaccaacgacctgaccagcggtaagggcaccatcagtaaagtcgacatcttgcagcgc
tactctgacgaaatcacccgtgacgtcaaacttgagcgccgtctgaaagtggtggtggac
tgcggcaacggcgcggccggcgtgatcgccccgcagctgctcgaagccctgaactgcgaa
gtgatccccttgttctgcgaggtcgacggcaacttccccaaccaccacccggacccgggc
aagcctgaaaacctggttgacctgatcgccaaggtcaaggaaaccggggctgacgtcggc
ctggcctttgacggcgacggcgaccgcgtgggggtggtgactgaaaccggtgaaatcgta
ttcccggaccgcctgctgatgctgttcgcccgcgacgtggttgcacgtaacccaggcgcc
gagatcattttcgacgtgaagtgcacccgccgcctcacgccgctgatcaaggaatacggc
ggtcgcccgctaatgtggaagaccggtcactcgttgatcaaaaagaaaatgaaagaaacc
ggcgcgctgttggccggcgaaatgagtggtcacgtgttcttcaaggagcgctggttcggc
tttgacgacggcatttacagtgccgcacgcctgctggagatcctcagcaaggaaaaatcc
accgccgaagagctgttccagaccttcccgaacgatatttctacgccagagatcaatatc
catgtgaccgaggagagcaaattcagcatcattgacgcactgcacgatgcgcaatggggc
gaaggcgccaacctgaccaccattgatggtgtgcgagtcgattacgccaaaggctggggc
ctggttcgcgcgtccaacaccacaccggtgctggtcctgcgtttcgaggcggataccgag
gctgagttgcagcgcatcaaggacgtgttccacgcccagttgaaacgtgttgcccctgat
ctccaattaccgttctga

DBGET integrated database retrieval system