KEGG   Pseudomonas fluorescens SBW25: PFLU5993Help
Entry
PFLU5993          CDS       T00899                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pfs00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6548535..6549155
Genome map
AA seq 206 aa AA seqDB search
MTHSTGTLYIISAPSGAGKSSLVKALTDADEQIRISVSHTTRAMRPGEVNGVHYHFVERT
EFVKMIEHGDFLERAEVFGNLYGTSQSHLQQTLDEGHDLILEIDWQGAEQVRQLMPKARS
IFILPPSLEALHQRLTNRGQDSDEIIEGRMREAVSEMSHYVDYDYLIINDDFAHALDDLK
AIFRTNQLQQKRQQQRFGKLLAELLG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgacccacagcaccggcaccctttacatcatttccgccccttcgggcgcgggcaagagc
agcctggtcaaggccctgaccgacgctgacgagcagatccgcatctcggtctcccacacc
actcgcgccatgcgcccgggtgaggtgaacggcgtgcactatcacttcgtcgagcgcacc
gagttcgtcaagatgattgaacatggcgacttcctcgagcgcgccgaagtgttcggcaac
ctctacggcacgtcgcagagccacttgcagcagaccctcgacgaaggccacgacctgatc
ctggaaatcgactggcagggcgccgagcaagtgcgccagttgatgcccaaggcgcgttcg
atcttcatcctgccgccgtccctggaggcgttgcaccagcgcttgaccaaccgtggccag
gacagtgacgagatcatcgaaggccgcatgcgtgaagccgtcagcgaaatgagccactac
gtcgactacgactacctgatcatcaacgacgattttgcccatgcactggatgatttgaag
gcgattttccgcaccaatcagctccagcaaaaacgccaacagcagcgtttcggcaaatta
ctcgccgaattgctcggctga

DBGET integrated database retrieval system