KEGG   Pseudomonas fluorescens SBW25: pQBR0181Help
Entry
pQBR0181          CDS       T00899                                 

Definition
putative exodeoxyribonuclease
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    pQBR0181
Enzymes [BR:pfs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     pQBR0181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pQBR103:184629..186851
Genome map
AA seq 740 aa AA seqDB search
MNMERVPEAVEGLLREQAILSSIQYRDPLGPWGIGTFRREDGTTFQATGSFGQPILYEEF
ILYGKWSPDIPGGDFDTASFSSMPPKALETLPRYLTSLTQNRVAIAATNKAVQHFGENLI
DILERAPSRLTEAGVSESDAELLGMTWATERSHQLALAQIDLEGIPPEKLATLQRRLGYM
TDLNLVLREDPYLLYVHFDDMLFSTAQSLAKRFRVTNDTVSAVKGAIVAVLRKEAWLGHS
YIEGVPLVDAVSKLLKLDRAVLYPLIKEGVTELRRAKVARAEERRLQLYNLYEIEKSLVE
KAIGWTRLTAAELEDLVPSEEMGIKLLRPLKLGAPATKTLSMGLCHLMAERLALVQCETL
HDQLTIVQGIQLFLNAFGTDALITASSKEMVTELQLTLGDEAPVVSYAELIGLDPVTGVP
QQNRASPIPTDVVVVVGTDSMGVEEIHYLLEAMPEAGRIFMLGAPKDLPSQTIGQPFDEM
AKVPEIRTFIASFWLPARTEQRKAAKDVWSGSIKPDDSFDPSKPISWLNTPRESIPDVVN
VLLRELSGSCQISPLHDIKPVVARQHAEVPGTDAVSWLTRSIAHEFVGKDDPVDFHGRAL
FKGMPVLVHQALSLEHPAFSIFEATELSGERMLATPRSGNPAVIDLKRNLNIFHGGVLTP
KFARGRVYEFVILIVLKEHMGLFNAELLSTLLNSAKRSLILVGELDGIADSFPGDEPTRV
RSSLSKWMATDGDQIDPPQK
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgaatatggaacgtgtacccgaagcagtcgaagggctgttgcgtgagcaagcaattcta
agttcaattcaatatcgtgacccactcggcccttgggggatcggtaccttccgcagagag
gacggcacgaccttccaggcgacaggaagcttcgggcaacccatcctgtatgaggagttc
atcctctacgggaaatggagcccagacatcccggggggggatttcgatactgcatcgttt
tcgtctatgccaccgaaagctctagaaacccttccgcggtacttgacgagcctgactcag
aacagggttgctattgctgcgactaacaaggctgttcagcacttcggcgagaatctcatc
gacattctcgagagagcaccctctcggctgacggaagcgggcgtttcagagagcgatgct
gagcttctcgggatgacgtgggcaacagagcgttcccatcagttagctttggcgcagata
gaccttgaaggcattcctccagagaagctggccaccctgcagcgccgcctggggtacatg
actgacttgaaccttgtgctgcgtgaagacccataccttctgtatgtccactttgacgac
atgctgttctcgacagcccaatctctcgctaagcgcttccgagtcactaacgacactgtg
tccgcagtcaagggcgcaatcgttgccgtgcttcgcaaggaagcttggttgggccatagc
tacatcgagggcgtccccctagtcgacgcagtgtccaaattactcaagctcgaccgcgca
gtgctctatccactaatcaaagagggtgtgaccgaattgaggcgggcaaaggtagctcgc
gcagaagaacgcagactacagctgtacaacctatatgagatcgaaaagtctctagttgaa
aaggcgatcggctggaccaggctgaccgcggccgagctagaggatctggttccgagcgag
gaaatgggcatcaaactgctccgccctctgaaacttggtgcccccgccacgaagactctt
tcaatgggtctatgccacttgatggctgagcgcttagctcttgtccagtgcgagaccctt
cacgatcaattgaccatcgtccagggcatacaactattcctgaatgctttcggaacagac
gcactcatcactgcatcttccaaggaaatggtgaccgagcttcaactgactctgggggat
gaggccccggtagtcagctatgcggagttgattggtctcgacccggtgacaggtgtccca
caacagaaccgggccagccctataccaaccgacgtggtcgtagtggttggcactgattct
atgggggtagaagaaattcactatctgctcgaagccatgcctgaagctggccgaattttc
atgcttggggcccccaaggatctcccgtcgcaaacaatcggccaaccctttgatgagatg
gccaaagtgccagagattcgaacattcatcgccagtttctggctgccggcccgtactgaa
cagcgaaaagcagcaaaggacgtgtggtcgggatcgattaagcctgatgacagttttgat
cctagcaagcccatcagttggctcaatacgccacgagagagcattcctgatgtggtgaat
gtgctgctccgtgagctgtctggctcatgccaaatatccccattgcacgacatcaaacct
gtcgtggcgcgccagcacgcagaggtcccaggtactgatgcagtttcctggcttactcgt
tcgatcgcccatgaattcgttggtaaggatgacccggtcgactttcatggacgagcattg
ttcaagggcatgcctgtgttagtgcaccaggctctctctttggaacaccctgccttctct
attttcgaggccactgaactttctggcgaaagaatgcttgccacgccccgctcgggaaac
ccagcggtgatcgacctcaagcggaatctcaacatctttcacggcggtgtactgacacca
aaatttgcgcgcggtcgagtttacgagtttgtaatcctgatcgtgctcaaggagcacatg
gggctgttcaatgccgaacttctctcgaccctcctgaacagtgcaaaacgatcattgatt
ttggtaggcgagctagacggtattgcagattcatttcctggcgatgagcccacacgggtg
aggtcatcactctcgaaatggatggccaccgatggcgatcaaattgacccgccgcagaag
taa

DBGET integrated database retrieval system