KEGG   Pyrococcus furiosus DSM 3638: PF0031Help
Entry
PF0031            CDS       T00075                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PF0031
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PF0031
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PF0031
Enzymes [BR:pfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PF0031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(38333..39247)
Genome map
AA seq 304 aa AA seqDB search
MVSYMDNETDPEGSPLLRAMKLEEKLNISKIYLKLEMHNPTRTHKDRIAKAHVKQAKDLG
FSGITVGTCGNYGVAIAYFAKKEGIKAVIFVPRQYRNSRVEEMKEYGADVIFVDGAYEEA
VLMSKIFAKTMNYYDANPGTQPAVDYEAYSLISKEILEEIEPYAVFVPVGNGSTLAGIYY
GFKKYGVMPRIIGVTTSYGNQVLNAFYTGRVEEVKDFVETDFNEPLVSSISFDLQNALEA
IKDSNGYIFGFGDDTALKYAKILEMSEGIKALPASTLTLVGLVKFVRKFGVNNENFVLLL
TGGI
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcatatatggataacgagacagatcccgaaggatccccattattgagggctatg
aagttagaggagaaactgaacatctccaagatatacttaaaacttgaaatgcacaatcct
acgagaactcacaaagatagaatagctaaagctcacgttaagcaggcgaaagatcttggc
ttttctggaattactgtaggaacttgtggtaattacggagtagctatagcatactttgct
aagaaggaagggataaaagcggtaatttttgttccaaggcagtataggaattcaagggta
gaagaaatgaaggagtatggagcagatgtcatatttgtagatggagcgtacgaagaggca
gttctcatgagcaaaatatttgcaaaaactatgaactattacgatgcaaacccaggaaca
cagcctgcagttgattatgaagcttattccttaatttcaaaggaaatcctggaagaaata
gagccatatgcggtatttgttcccgtaggaaacggctccacactagctggaatttattat
ggattcaaaaaatatggagttatgcctaggataattggggtcacaactagctatggaaac
caagtgctcaacgctttctatacaggaagagttgaagaagtaaaagacttcgttgagact
gattttaatgagcccctcgtttcctcgatatccttcgatttgcagaatgcgctcgaagcc
ataaaagattctaacggctatatttttggttttggtgatgatacagcattaaaatatgca
aagattttggagatgagtgaggggataaaagcacttccagcttccactctaactttagtt
ggacttgttaaatttgtgagaaaatttggcgtgaataatgagaattttgtgttgctccta
actggagggatttga

DBGET integrated database retrieval system