KEGG   Pyrococcus furiosus DSM 3638: PF0031Help
Entry
PF0031            CDS       T00075                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pfu01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pfu00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:pfu00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(38333..39247)
Genome map
AA seq 304 aa AA seqDB search
MVSYMDNETDPEGSPLLRAMKLEEKLNISKIYLKLEMHNPTRTHKDRIAKAHVKQAKDLG
FSGITVGTCGNYGVAIAYFAKKEGIKAVIFVPRQYRNSRVEEMKEYGADVIFVDGAYEEA
VLMSKIFAKTMNYYDANPGTQPAVDYEAYSLISKEILEEIEPYAVFVPVGNGSTLAGIYY
GFKKYGVMPRIIGVTTSYGNQVLNAFYTGRVEEVKDFVETDFNEPLVSSISFDLQNALEA
IKDSNGYIFGFGDDTALKYAKILEMSEGIKALPASTLTLVGLVKFVRKFGVNNENFVLLL
TGGI
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcatatatggataacgagacagatcccgaaggatccccattattgagggctatg
aagttagaggagaaactgaacatctccaagatatacttaaaacttgaaatgcacaatcct
acgagaactcacaaagatagaatagctaaagctcacgttaagcaggcgaaagatcttggc
ttttctggaattactgtaggaacttgtggtaattacggagtagctatagcatactttgct
aagaaggaagggataaaagcggtaatttttgttccaaggcagtataggaattcaagggta
gaagaaatgaaggagtatggagcagatgtcatatttgtagatggagcgtacgaagaggca
gttctcatgagcaaaatatttgcaaaaactatgaactattacgatgcaaacccaggaaca
cagcctgcagttgattatgaagcttattccttaatttcaaaggaaatcctggaagaaata
gagccatatgcggtatttgttcccgtaggaaacggctccacactagctggaatttattat
ggattcaaaaaatatggagttatgcctaggataattggggtcacaactagctatggaaac
caagtgctcaacgctttctatacaggaagagttgaagaagtaaaagacttcgttgagact
gattttaatgagcccctcgtttcctcgatatccttcgatttgcagaatgcgctcgaagcc
ataaaagattctaacggctatatttttggttttggtgatgatacagcattaaaatatgca
aagattttggagatgagtgaggggataaaagcacttccagcttccactctaactttagtt
ggacttgttaaatttgtgagaaaatttggcgtgaataatgagaattttgtgttgctccta
actggagggatttga

DBGET integrated database retrieval system