KEGG   Pyrococcus furiosus DSM 3638: PF0073Help
Entry
PF0073            CDS       T00075                                 

Definition
beta-glucosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PF0073
  Lipid metabolism
   00600 Sphingolipid metabolism
    PF0073
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PF0073
Enzymes [BR:pfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PF0073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(78019..79437)
Genome map
AA seq 472 aa AA seqDB search
MKFPKNFMFGYSWSGFQFEMGLPGSEVESDWWVWVHDKENIASGLVSGDLPENGPAYWHL
YKQDHDIAEKLGMDCIRGGIEWARIFPKPTFDVKVDVEKDEEGNIISVDVPESTIKELEK
IANMEALEHYRKIYSDWKERGKTFILNLYHWPLPLWIHDPIAVRKLGPDRAPAGWLDEKT
VVEFVKFAAFVAYHLDDLVDMWSTMNEPNVVYNQGYINLRSGFPPGYLSFEAAEKAKFNL
IQAHIGAYDAIKEYSEKSVGVIYAFAWHDPLAEEYKDEVEEIRKKDYEFVTILHSKGKLD
WIGVNYYSRLVYGAKDGHLVPLPGYGFMSERGGFAKSGRPASDFGWEMYPEGLENLLKYL
NNAYELPMIITENGMADAADRYRPHYLVSHLKAVYNAMKEGADVRGYLHWSLTDNYEWAQ
GFRMRFGLVYVDFETKKRYLRPSALVFREIATQKEIPEELAHLADLKFVTRK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcccaaaaaacttcatgtttggatattcttggtctggtttccagtttgagatg
ggactgccaggaagtgaagtggaaagcgactggtgggtgtgggttcacgacaaggagaac
atagcatcaggtctagtaagtggagatctaccagagaacggcccagcatattggcacctc
tataagcaagatcatgacattgcagaaaagctaggaatggattgtattagaggtggcatt
gagtgggcaagaatttttccaaagccaacatttgacgttaaagttgatgtggaaaaggat
gaagaaggcaacataatttccgtagacgttccagagagtacaataaaagagctagagaaa
attgccaacatggaggcccttgaacattatcgcaagatttactcagactggaaggagagg
ggcaaaaccttcatattaaacctctaccactggcctcttccattatggattcatgaccca
attgcagtaaggaaacttggcccggatagggctcctgcaggatggttagatgagaagaca
gtggtagagtttgtgaagtttgccgccttcgttgcttatcaccttgatgacctcgttgac
atgtggagcacaatgaacgaaccaaacgtagtctacaatcaaggttacattaatctacgt
tcaggatttccaccaggatatctaagctttgaagcagcagaaaaggcaaaattcaactta
attcaggctcacatcggagcatatgatgccataaaagagtattcagaaaaatccgtggga
gtgatatacgcctttgcttggcacgatcctctagcggaggagtataaggatgaagtagag
gaaatcagaaagaaagactatgagtttgtaacaattctacactcaaaaggaaagctagac
tggatcggcgtaaactactactccaggctggtatatggagccaaagatggacacctagtt
cctttacctggatatggatttatgagtgagagaggaggatttgcaaagtcaggaagacct
gctagtgactttggatgggaaatgtacccagagggccttgagaaccttcttaagtattta
aacaatgcctacgagctaccaatgataattacagagaacggtatggccgatgcagcagat
agatacaggccacactatctcgtaagccatctaaaggcagtttacaatgctatgaaagaa
ggtgctgatgttagagggtatctccactggtctctaacagacaactacgaatgggcccaa
gggttcaggatgagatttggattggtttacgtggatttcgagacaaagaagagatattta
aggccaagcgccctggtattcagagaaatagccactcaaaaagaaattccagaagaatta
gctcacctcgcagacctcaaatttgttacaagaaagtag

DBGET integrated database retrieval system