KEGG   Pyrococcus furiosus DSM 3638: PF0075Help
Entry
PF0075            CDS       T00075                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PF0075
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PF0075
  Lipid metabolism
   00071 Fatty acid degradation
    PF0075
  Amino acid metabolism
   00350 Tyrosine metabolism
    PF0075
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PF0075
   00626 Naphthalene degradation
    PF0075
Enzymes [BR:pfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PF0075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
80328..81500
Genome map
AA seq 390 aa AA seqDB search
MFEISIYLPTEIVFGPGKLEMLPKLVKKHGLSGKALIVTGRRSTKETGVLYRVQELLKQA
GVESIVFDKIIPNPISTHVDEGAEIARKENVSFVVGLGGGSAIDSAKAIAMTAASGGKYW
DYVPAVGGGKKPTGALPIVAIPTTHGTGTEADPYAVITNPETKEKQGIGYDVLFPKFSIV
DPELMLTLPKDQTVYTSMDAFYHSIEAFLNVRANPYSDVLALDSMRRIVTYLPLAYENLR
NLEARTQLAWASTEAGITETVTGVVANHALEHGLSGFYPEVPHGLGLCILGPYLFEYILD
YAYEKLAIVGREVFGVYEPNDRKAAELAIKKLRDFQSLFGVNKKLRELGVKEEDIPEMAR
TAYRMMKPVIEATPGDLKVEDLEEIYRRAY
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagatatcaatttatcttcccacagaaatagtttttggtcctgggaagcttgaa
atgcttcctaaactagtgaagaagcatgggctttctgggaaggccctaatagtaactgga
aggagaagcacaaaggaaactggagttctttatagagttcaagaactacttaagcaagct
ggggtagagagcatagtttttgacaaaattattccaaatccaatatctactcatgtggat
gaaggggcagagatagcgagaaaagaaaatgttagctttgttgttggcttgggtggtgga
agtgcgatagatagtgcaaaagctatagcaatgactgccgccagtggaggtaaatattgg
gactatgttccagctgtgggaggaggaaagaagcctactggagcgcttccaatagttgca
attccaacaacccacgggactggaacggaggctgatccttatgctgttataactaatcct
gaaacaaaggagaagcagggaattggatatgatgttctcttccccaaattctctatagtt
gatccagaacttatgcttactcttccaaaagatcaaacagtgtacacttcaatggatgct
ttctaccactccattgaggcctttcttaatgttagagcaaatccatattcggatgttctg
gctctcgactcaatgaggcgcattgttacataccttccattggcctacgaaaacttgaga
aatcttgaagcaagaacgcaacttgcctgggcaagtactgaggctggaataacggaaacg
gtaacgggagttgtggcaaatcatgcacttgagcatggtctaagtggattctatcctgaa
gtgcctcatggtctgggcctctgcattctaggaccctacctctttgaatacattctcgac
tatgcctatgaaaagttggcgatagtcggaagagaggtatttggagtttacgagccaaat
gacagaaaggcagcagagctagctattaagaagctacgtgacttccagagcctctttgga
gtaaacaagaagctcagagaattaggggttaaagaggaagacattccagagatggctagg
actgcttatagaatgatgaaacctgttatagaggcaacaccgggagatttgaaagttgaa
gacttggaagagatctatagaagagcatactaa

DBGET integrated database retrieval system