KEGG   Pyrococcus furiosus DSM 3638: PF0075Help
Entry
PF0075            CDS       T00075                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:pfu01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pfu00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pfu00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:pfu00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:pfu00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:pfu00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
80328..81500
Genome map
AA seq 390 aa AA seqDB search
MFEISIYLPTEIVFGPGKLEMLPKLVKKHGLSGKALIVTGRRSTKETGVLYRVQELLKQA
GVESIVFDKIIPNPISTHVDEGAEIARKENVSFVVGLGGGSAIDSAKAIAMTAASGGKYW
DYVPAVGGGKKPTGALPIVAIPTTHGTGTEADPYAVITNPETKEKQGIGYDVLFPKFSIV
DPELMLTLPKDQTVYTSMDAFYHSIEAFLNVRANPYSDVLALDSMRRIVTYLPLAYENLR
NLEARTQLAWASTEAGITETVTGVVANHALEHGLSGFYPEVPHGLGLCILGPYLFEYILD
YAYEKLAIVGREVFGVYEPNDRKAAELAIKKLRDFQSLFGVNKKLRELGVKEEDIPEMAR
TAYRMMKPVIEATPGDLKVEDLEEIYRRAY
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagatatcaatttatcttcccacagaaatagtttttggtcctgggaagcttgaa
atgcttcctaaactagtgaagaagcatgggctttctgggaaggccctaatagtaactgga
aggagaagcacaaaggaaactggagttctttatagagttcaagaactacttaagcaagct
ggggtagagagcatagtttttgacaaaattattccaaatccaatatctactcatgtggat
gaaggggcagagatagcgagaaaagaaaatgttagctttgttgttggcttgggtggtgga
agtgcgatagatagtgcaaaagctatagcaatgactgccgccagtggaggtaaatattgg
gactatgttccagctgtgggaggaggaaagaagcctactggagcgcttccaatagttgca
attccaacaacccacgggactggaacggaggctgatccttatgctgttataactaatcct
gaaacaaaggagaagcagggaattggatatgatgttctcttccccaaattctctatagtt
gatccagaacttatgcttactcttccaaaagatcaaacagtgtacacttcaatggatgct
ttctaccactccattgaggcctttcttaatgttagagcaaatccatattcggatgttctg
gctctcgactcaatgaggcgcattgttacataccttccattggcctacgaaaacttgaga
aatcttgaagcaagaacgcaacttgcctgggcaagtactgaggctggaataacggaaacg
gtaacgggagttgtggcaaatcatgcacttgagcatggtctaagtggattctatcctgaa
gtgcctcatggtctgggcctctgcattctaggaccctacctctttgaatacattctcgac
tatgcctatgaaaagttggcgatagtcggaagagaggtatttggagtttacgagccaaat
gacagaaaggcagcagagctagctattaagaagctacgtgacttccagagcctctttgga
gtaaacaagaagctcagagaattaggggttaaagaggaagacattccagagatggctagg
actgcttatagaatgatgaaacctgttatagaggcaacaccgggagatttgaaagttgaa
gacttggaagagatctatagaagagcatactaa

DBGET integrated database retrieval system