KEGG   Pyrococcus furiosus DSM 3638: PF0108Help
Entry
PF0108            CDS       T00075                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pfu00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
113144..113713
Genome map
AA seq 189 aa AA seqDB search
MRNIKAKLIHYSKLAHRKGLTGSFGGNMSIRVGNYVFIKGTGSVMEELTESQIAVVKLDG
KVVSSVRPSSEYRLHLGVYRNRPEVRAVVHLHPPYSIVLSIFEREAPMITPEAELYLKKV
PVLPFRPAGSVELAQQVSEAMKGYDAVVLERHGVVTVGRSLREAFYKAELVEEVARLWYQ
KFIASREKN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaggaacattaaggcgaagcttatacattattcaaagcttgcacatagaaaaggctta
actggttcatttggaggaaacatgagcattagagttgggaactacgtgttcataaagggg
actggaagcgtgatggaagagcttaccgaaagtcagattgctgttgtaaaattggatggg
aaagtggtttcttctgtaagaccctcctccgaataccgccttcacttgggagtttatagg
aataggcccgaagttagggcagtagttcatcttcatcctccttactccatagtcctctct
atttttgagagggaggctcctatgataacccctgaggctgagttatatcttaagaaagtc
cccgtgcttccatttagacctgcagggagtgttgaattggctcaacaagtctctgaagct
atgaagggttatgatgcagttgtacttgaaagacatggggttgttacagttggaagaagc
cttagagaggccttttataaggctgaactcgttgaggaagtggctagactctggtaccaa
aagtttatagcctccagagagaaaaactaa

DBGET integrated database retrieval system