KEGG   Pyrococcus furiosus DSM 3638: PF0108Help
Entry
PF0108            CDS       T00075                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PF0108
Enzymes [BR:pfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     PF0108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
113144..113713
Genome map
AA seq 189 aa AA seqDB search
MRNIKAKLIHYSKLAHRKGLTGSFGGNMSIRVGNYVFIKGTGSVMEELTESQIAVVKLDG
KVVSSVRPSSEYRLHLGVYRNRPEVRAVVHLHPPYSIVLSIFEREAPMITPEAELYLKKV
PVLPFRPAGSVELAQQVSEAMKGYDAVVLERHGVVTVGRSLREAFYKAELVEEVARLWYQ
KFIASREKN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaggaacattaaggcgaagcttatacattattcaaagcttgcacatagaaaaggctta
actggttcatttggaggaaacatgagcattagagttgggaactacgtgttcataaagggg
actggaagcgtgatggaagagcttaccgaaagtcagattgctgttgtaaaattggatggg
aaagtggtttcttctgtaagaccctcctccgaataccgccttcacttgggagtttatagg
aataggcccgaagttagggcagtagttcatcttcatcctccttactccatagtcctctct
atttttgagagggaggctcctatgataacccctgaggctgagttatatcttaagaaagtc
cccgtgcttccatttagacctgcagggagtgttgaattggctcaacaagtctctgaagct
atgaagggttatgatgcagttgtacttgaaagacatggggttgttacagttggaagaagc
cttagagaggccttttataaggctgaactcgttgaggaagtggctagactctggtaccaa
aagtttatagcctccagagagaaaaactaa

DBGET integrated database retrieval system