KEGG   Pyrococcus furiosus DSM 3638: PF0363Help
Entry
PF0363            CDS       T00075                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PF0363
Enzymes [BR:pfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PF0363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
376900..379218
Genome map
AA seq 772 aa AA seqDB search
MVKPIFLDGKRIVVYGGTLQYFRVPRNSWERMLKKMKSHGLNTIDTYIAWNWHEPQEGLF
DFTGETHPQRDLVGFLDLAQKLGFYVIIRPGPYICGEWKNGGIPEWLINSHPEILAKGPN
GTLPRDIYYPPITYLHPTYLEYVMKWYENVFPIIKEYLYSNGGPIINVTIDDEPSYWETI
FQAFLTDYNEIVVKENGIWHSWLKENYQLDELEERYGQKFSDYAEIVPPTSFSEPLPKIL
DWHHFKIWMINEYVRILYEKIKKYVDVPISILDPYLLLAAWKEFYLYVTKHKLDIHLWTE
FWYSFYRTFDFKEDRLGHLYYKTGVYRYYINKLKTPPLSIETQTSLANVIEKDEAELLYA
LLPALGIHNINYYLYVGGENPKGYESHNGATWDVYSPIGLDGRERQHVEPIKWIGEFLKS
NMDFIESQLKPKVAFGMYEPYEALSMWGHRPESFEESVNLQEYLFGERGLLTLLAMSNVP
FDVIDLELSTVEEMLQYEQIWIYSLDFMSREVQEKLARYVEEGGNLVILPTLPSLDENMK
PYTKLRDFLGIEVEKAKARDNMRLIPYISVDAEEIDRMVVRNVVREVKGGKAIAWVGDKV
VGVMVRKGKGSAVVLGFRLQYYSSYHDLHRKFVDKILQLQGIERDFEVSNRDIIVIPRGN
YLVVVNPRDDKVTGKVRYRGVEFNVELNKRGVLYIPINVEINGIKVLYATATPVGRGEGT
IRFRNHLANVTEIAINGKIKEVSGGYILQEKSSGEKNIYVIKHESETFEIRV
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacctatcttccttgatggtaaaaggattgttgtttatggaggtacccttcag
tattttagagttcccaggaactcctgggaaagaatgctaaagaaaatgaagtctcacggg
ctaaacaccattgatacgtacattgcttggaattggcacgagccccaagaaggactcttc
gactttactggcgaaactcacccccaaagagatctcgtcggttttcttgatctagcacaa
aaactcggcttttacgttatcataagacctggcccatacatttgtggagagtggaaaaat
ggaggcatccctgagtggttgattaactctcatccagaaatacttgcaaaaggcccgaat
ggtactcttccaagggatatatactatcctccaatcacatacctccatcccacttacttg
gaatatgtaatgaagtggtatgagaatgtttttcctataataaaggaatatctgtactcc
aatggggggcctataataaacgtgacgattgatgacgaaccttcctactgggaaaccatc
ttccaggcattcttgaccgattacaacgaaatagtagttaaggagaatgggatctggcac
tcttggctaaaggaaaactaccagttggatgaattggaggagagatacggtcagaagttt
tcagattatgctgagattgtcccaccaacgtcattctcagagccccttccaaagatactc
gactggcatcacttcaagatatggatgatcaacgagtacgtaaggatactctacgaaaag
ataaagaagtacgttgatgttccaattagcattttagatccctatttactcttagccgca
tggaaggagttttacctctacgtaaccaagcacaagctcgacatccacctatggacggag
ttctggtactcattctacagaacatttgacttcaaagaagacagactcggccacctctac
tataagacgggggtttatagatattacataaacaagctgaagactcccccactaagcata
gagacccaaacatccctcgccaatgttatagagaaggatgaggccgagctcctctatgcc
ctccttccagctttgggaatccacaacataaactactatctctacgtgggtggcgaaaat
ccgaaaggttatgaatcacacaacggagctacctgggacgtgtattcccccataggattg
gatggaagagaaagacagcacgtggaaccaataaagtggattggcgagttcttaaagtct
aacatggacttcatcgagtcccaactaaagccaaaagttgcctttgggatgtacgagcct
tatgaagccttaagcatgtggggacatcggccagaaagcttcgaagagagcgtaaatctc
caagaatatctctttggggagagaggattgctcacactcttggccatgagcaatgttccc
tttgacgtcatagaccttgaactttccactgtagaggagatgctccaatatgagcagatt
tggatttacagcctggatttcatgagcagagaagttcaagaaaagcttgctagatacgtg
gaagagggaggaaacctcgtgatcctaccaacccttccatcccttgatgagaacatgaag
ccctacacaaagctgagggacttcctaggaattgaagttgagaaggccaaggcaagggat
aacatgaggttaattccctacatcagcgttgatgcagaggagatagacaggatggtcgtc
agaaacgtcgttagggaggttaaaggagggaaagctatagcttgggttggagataaagta
gtaggggttatggtaaggaaaggaaaaggttctgcagttgtcttagggttcaggcttcag
tactactcgagctaccacgatctacacaggaagtttgttgataagatactccagctccaa
gggattgaaagggattttgaagtctcaaacagagacataatagtaattccaagagggaat
tatctggtggtggtaaatcccagggacgacaaggttactggaaaagttagatacaggggt
gtcgagtttaatgttgagcttaataagaggggagttctctacatcccaattaatgtggaa
ataaacggcattaaggtgctctatgccacagcaactccagtgggaaggggagagggaaca
attagatttagaaaccatttggcaaatgtaactgaaattgcaattaacggcaagatcaag
gaagtctcaggggggtatatcctccaagagaagagctcaggagagaaaaacatctatgtg
ataaaacacgagagcgaaacattcgaaataagagtttag

DBGET integrated database retrieval system