KEGG   Pyrococcus furiosus DSM 3638: PF0464Help
Entry
PF0464            CDS       T00075                                 

Definition
glyceraldehyde-3-phosphate:ferredoxin oxidoreductase
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PF0464
   01230 Biosynthesis of amino acids
    PF0464
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PF0464
Enzymes [BR:pfu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     PF0464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(478142..480103)
Genome map
AA seq 653 aa AA seqDB search
MKFSVLKLDVGKREVEAQEIEREDIFGVVDYGIMRHNELRTYEVDPYDPRNIVIFGIGPF
AGSVLPGSHRLVFFFRSPLYGGLFPSTMGGAGYQFKNVGVDFVEIHGKAEKPTVIILKND
GEKLSVDFYEIELEKLLDVWKEYKGEEGVYALTQYLLDNLASVFEGMEFRIAVVGPAALN
TNMGAIFSQALRNGKRAVGSEDWAARGGPGSVLLRAHNVVAIAFGGKKRKREFPGEDISD
VKVAKRVVEGIHKKAQRDVINESTVKYRYNPKLNTGGTFGGNYPAEGDLVPVLNWQMPYI
PKEERIKIHELIMKYYWEPFNKESIQPKNWTTCGEPCPVVCKKHRKGHHVEYEPYEANGP
LSGSIYLYASDISVHAVDAMGFDAIEFGGTAAWVLELVHKGLLKPAEVGISDVPEFTKDD
LITKPVEASEKNAKLVAELAHSIAFGKTEVARIIGMGKRKASKILDEKFKDRLSYGESFK
DYGVYTPLGDDGEINPTMYWAIGNFIPLPIQGRYWTFYQFGVFLEPEELAQKIVSSALWE
FWYDNVGWCRFHRGWMKKVLKALFMEAYGVSIDMEEHAKKQIRKLIDYLKKAGYEPVFWD
SMRVIDLVAKGSEEFGNENWAKKFKEDKIGTAKEYLKRVLDAYSQLIGTEWTL
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttcagttctaaaactagatgtaggtaaaagggaagtagaagctcaagagata
gaaagggaggacattttcggagttgtagactacggaatcatgagacacaatgaactaagg
acatatgaagttgatccctacgatccaaggaatatagttatctttggaataggacctttc
gcaggttctgttttgcctggaagtcacaggctagtattcttctttaggtctcccctctat
ggaggtctattcccctccacaatgggtggagctggatatcaattcaaaaatgtaggtgtt
gatttcgttgaaattcatggaaaagctgagaagcctaccgtgataattctaaagaatgac
ggtgagaagttaagcgttgacttttatgaaattgagcttgagaaactcttagatgtatgg
aaagaatacaaaggagaagagggggtttatgcactaacgcaataccttcttgataaccta
gcgagtgtatttgaaggcatggagtttagaattgccgtagttggcccagctgcacttaac
actaacatgggtgcaattttctcccaagctctaagaaatggtaagagggctgtaggtagc
gaagactgggccgcaaggggaggtcctggaagtgttcttttgagggctcacaatgtagtt
gccatagcattcggtggaaagaagagaaagagagaattcccaggtgaggacataagcgat
gtaaaagttgccaaaagagtggttgaaggaattcacaagaaggctcagagggatgtgatt
aatgaaagcaccgtgaagtatagatacaatccaaaacttaacacaggaggtacatttgga
ggtaattacccagctgaaggtgatttagtgccagttttaaactggcaaatgccttacatt
ccaaaagaagagaggataaagattcacgagctcataatgaaatattactgggaacccttc
aacaaagagtcaatacaaccaaagaactggactacctgtggcgagccctgtccagtagtt
tgtaagaagcacagaaaaggacatcacgttgaatatgagccctacgaagcaaacggtcct
ctcagcggaagtatatacctctatgcaagcgatattagtgttcatgcagtagatgccatg
ggatttgatgcaattgaattcggcggtacagcagcgtgggtgttggagctggttcacaaa
ggtttactaaagcctgcagaggttggaattagcgatgttccagaatttacaaaggacgat
ctaatcacaaagcctgtggaagcaagcgagaaaaatgctaaacttgttgcagagctggcc
cactcaatagcttttggaaaaacggaagttgctaggataattggaatgggtaagaggaaa
gcaagcaagatcttagatgaaaagttcaaggacagactaagttatggagagagctttaag
gattatggagtctacacacccttaggtgacgatggagagataaacccaacaatgtattgg
gccattggaaacttcataccattgcctattcaaggtagatactggacattctatcaattt
ggagtattcctagaaccagaggaacttgctcagaaaattgtttcaagtgctttgtgggag
ttctggtacgataacgtaggctggtgtcgtttccacagagggtggatgaagaaagtccta
aaggctctgtttatggaggcatatggtgtcagcattgacatggaagagcacgccaaaaaa
cagattagaaagcttatagactaccttaagaaggcaggttatgagccagtattttgggac
agcatgagggtaatcgacttagttgcaaagggcagtgaagagtttggaaacgaaaactgg
gccaagaaattcaaagaagacaaaattggaacggccaaagagtacttgaagagagtccta
gatgcatacagtcaattaataggaactgagtggactctttaa

DBGET integrated database retrieval system