KEGG   Pyrococcus furiosus DSM 3638: PF0537Help
Entry
PF0537            CDS       T00075                                 

Definition
(GenBank) hypothetical protein
  KO
K07578  
homologs of the eukaryotic argonaute protein
Organism
pfu  Pyrococcus furiosus DSM 3638
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(553680..555992)
Genome map
AA seq 770 aa AA seqDB search
MKAKVVINLVKINKKIIPDKIYVYRLFNDPEEELQKEGYSIYRLAYENVGIVIDPENLII
ATTKELEYEGEFIPEGEISFSELRNDYQSKLVLRLLKENGIGEYELSKLLRKFRKPKTFG
DYKVIPSVEMSVIKHDEDFYLVIHIIHQIQSMKTLWELVNKDPKELEEFLMTHKENLMLK
DIASPLKTVYKPCFEEYTKKPKLDHNQEIVKYWYNYHIERYWNTPEAKLEFYRKFGQVDL
KQPAILAKFASKIKKNKNYKIYLLPQLVVPTYNAEQLESDVAKEILEYTKLMPEERKELL
ENILAEVDSDIIDKSLSEIEVEKIAQELENKIRVRDDKGNSVPISQLNVQKSQLLLWTNY
SRKYPVILPYEVPEKFRKIREIPMFIILDSGLLADIQNFATNEFRELVKSMYYSLAKKYN
SLAKKARSTNEIGLPFLDFRGKEKVITEDLNSDKGIIEVVEQVSSFMKGKELGLAFIAAR
NKLSSEKFEEIKRRLFNLNVISQVVNEDTLKNKRDKYDRNRLDLFVRHNLLFQVLSKLGV
KYYVLDYRFNYDYIIGIDVAPMKRSEGYIGGSAVMFDSQGYIRKIVPIKIGEQRGESVDM
NEFFKEMVDKFKEFNIKLDNKKILLLRDGRITNNEEEGLKYISEMFDIEVVTMDVIKNHP
VRAFANMKMYFNLGGAIYLIPHKLKQAKGTPIPIKLAKKRIIKNGKVEKQSITRQDVLDI
FILTRLNYGSISADMRLPAPVHYAHKFANAIRNEWKIKEEFLAEGFLYFV
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgaaagttgttattaatctggtaaagataaataaaaaaataattccagataaa
atatatgtatataggctctttaatgacccagaggaagaacttcaaaaagagggatattct
atttatcgccttgcatatgaaaacgttggtattgttattgatccagagaatctgattatt
gccaccacaaaagagcttgaatatgagggagaatttattcccgagggtgaaatatcattc
tcggaattgcgtaatgactatcagagtaaacttgtcttaagattgttgaaggagaatgga
ataggtgaatatgaattatcgaaacttcttaggaagtttagaaaaccaaaaacttttggg
gattataaggtcattccaagcgttgagatgagtgtgataaagcatgatgaagatttttat
ttagtaattcatataattcatcaaatacaatcaatgaaaacactgtgggagcttgtaaac
aaagaccctaaagagcttgaagagtttttaatgactcacaaggaaaatttaatgctgaag
gacattgcgtcaccacttaaaactgtttataagccttgctttgaagagtatactaaaaaa
ccaaaacttgatcataatcaagaaatagtaaagtactggtataattatcatattgaaaga
tattggaatactccagaagctaaattagagttttatagaaaatttggccaagttgattta
aaacaacctgcaattctagcgaaatttgcatctaaaataaagaaaaacaaaaattacaag
atatatctcttgccccaattagttgtcccaacttataacgccgaacaattagaaagtgac
gtggcgaaagaaattttagaatatacaaaactgatgccagaagaacgtaaagagctttta
gaaaacatccttgcagaagttgatagtgacattatagacaaatcattaagtgaaattgaa
gtagaaaaaattgcacaagaattggaaaacaaaataagggttagagatgacaaagggaac
agtgtaccaatttctcaattaaatgttcaaaaatctcaattactactttggacgaattat
tcacgaaaatatccagttatattgccttatgaagttccagaaaagttcagaaaaatacgg
gagataccaatgtttataattctagattcaggacttcttgccgacattcaaaattttgca
actaatgaattcagggagttagtaaagagcatgtactatagtcttgccaaaaaatacaat
agtcttgccaaaaaagcaaggtcaacaaatgaaataggattaccctttttagactttcgt
gggaaagaaaaggttataactgaagatttaaactctgacaaaggtattatagaagttgtg
gagcaggtatctagtttcatgaaaggaaaagaactaggcctagcctttatagctgcaaga
aataaactttcatctgagaagtttgaggaaattaaaaggagactctttaatttaaatgta
atatctcaagtggttaacgaagatactttaaaaaataaaagagacaaatacgatagaaat
cgacttgatctatttgtcagacacaacttactttttcaagtattatctaaacttggagta
aagtattatgtgctagattacaggttcaattatgactacatcattggaattgatgttgct
cccatgaagcgttctgagggatatataggtggtagtgccgtaatgtttgactctcaaggt
tacatacgaaaaattgtcccaattaaaattggtgaacaaagaggagaatcagttgacatg
aatgagtttttcaaagaaatggttgataaatttaaagagttcaatattaagctagataat
aagaaaatactacttctaagagatggaagaattactaataacgaagaagaagggctcaag
tatatttccgagatgtttgatattgaggtggtcacgatggacgtgataaaaaatcaccct
gtgagagcctttgctaatatgaaaatgtactttaacctaggtggtgcaatatacctaatc
ccccataagctcaaacaagctaaaggaacaccaataccaataaagttagccaaaaagagg
ataattaagaatggaaaagtcgagaagcagagtatcactagacaggacgtcttagatatc
ttcattttaactcgtcttaactatgggagtatttctgctgatatgcggttgccagcaccc
gttcactatgctcacaagtttgcaaatgcaatcagaaatgaatggaaaataaaagaagag
ttccttgctgagggatttttgtattttgtttga

DBGET integrated database retrieval system