KEGG   Pyrococcus furiosus DSM 3638: PF0588Help
Entry
PF0588            CDS       T00075                                 

Definition
(GenBank) phospho-sugar mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
pfu00010  Glycolysis / Gluconeogenesis
pfu00030  Pentose phosphate pathway
pfu00051  Fructose and mannose metabolism
pfu00052  Galactose metabolism
pfu00230  Purine metabolism
pfu00500  Starch and sucrose metabolism
pfu00520  Amino sugar and nucleotide sugar metabolism
pfu00521  Streptomycin biosynthesis
pfu01100  Metabolic pathways
pfu01110  Biosynthesis of secondary metabolites
pfu01120  Microbial metabolism in diverse environments
pfu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PF0588
   00030 Pentose phosphate pathway
    PF0588
   00051 Fructose and mannose metabolism
    PF0588
   00052 Galactose metabolism
    PF0588
   00500 Starch and sucrose metabolism
    PF0588
   00520 Amino sugar and nucleotide sugar metabolism
    PF0588
  Nucleotide metabolism
   00230 Purine metabolism
    PF0588
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PF0588
Enzymes [BR:pfu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PF0588
    5.4.2.8  phosphomannomutase
     PF0588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AAL80712
UniProt: Q8U383
Position
complement(606805..608172)
Genome map
AA seq 455 aa AA seqDB search
MGKLFGTFGVRGTANKDITPEFALKIGMAFGTLLRREGKKKPVVVVGRDTRVSGEMLKSA
LISGLLSVGCDVIDVGIAPTPAIQWATNHLKADGGAVITASHNPPEYNGIKLLEPNGMGL
KKEREAIVEEIFFKEDFDRVEWHEIGEVREVDIIKPYIEAIKSKVDVEAIKKRRPFVVVD
TSNGAGSLTLPYLLRELGCKVVSVNAHPDGHFPARNPEPNEENLKGFMEIVKALGADFGV
AQDGDADRAVFIDENGRFIQGDKTFALVADAVLRENGGGLLVTTVATSNLLDDIAKKHGA
KVMRTKVGDLIVARALYENNGTIGGEENGGVIFPDHVLGRDGAMTVAKVVEIFAKSGKKF
SELIDELPKYYQIKTKRHVEGDRYAIVNKVAEMARERGYTVDTTDGAKIIFEDGWVLVRA
SGTEPIIRIFSEAKSEEKAQEYLDLGIELLEKALS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggggaagctgtttggaacatttggagtgagggggacagcaaacaaggacataacccca
gaattcgctctaaaaataggaatggcattcggaacccttctaaggagagaggggaagaag
aaaccagttgtagtagtcggtagggacacgagagtgagtggggaaatgctaaagagtgct
ctaataagcggacttctaagtgttggatgtgatgtaatcgatgtgggaattgctccaact
cccgctattcagtgggcaacaaatcaccttaaagctgatgggggagcagttataacagcc
tcccacaacccaccagaatacaatggaataaagctacttgagccgaatgggatgggatta
aagaaggaaagagaagctattgtcgaggagatattcttcaaggaagactttgacagggta
gagtggcatgaaatcggggaagttagagaagttgatataataaagccttacattgaagct
ataaaatccaaggtagatgttgaagccataaagaagaggaggccatttgtggttgtggac
acatcaaatggagcaggctccctaaccctaccatacctgctaagagagctcggatgtaaa
gttgtttccgtaaacgcccacccagatggccacttcccagctagaaaccccgaaccaaat
gaggagaacctcaaaggattcatggagatagttaaggccttgggagcagactttggagtt
gcccaggatggagatgcagacagagcagtattcatagatgaaaacggaagattcattcag
ggtgataagacgtttgcactcgttgccgatgcagtgttgagggagaatggtggaggatta
ctagttacaaccgtggcaacctccaacttgctcgatgacatagcgaagaagcatggagct
aaggtaatgagaactaaagtaggtgacctaatagttgccagggccctctatgagaacaac
ggaacaataggcggggaagagaacggtggagtaatcttcccagatcacgtactgggaaga
gatggtgcaatgaccgtggctaaggttgttgaaatattcgccaagagcggtaagaagttc
agcgagctcatagatgagctgccgaagtactaccagataaagaccaagaggcacgttgag
ggagataggtatgcaatagtaaataaggttgcagagatggcgagggagaggggatacact
gttgacacaactgatggagctaagataatatttgaagatggatgggttttggttagggca
agtggaacggagccaataataaggatattcagcgaagcaaagagcgaagagaaagcccag
gagtacttagacctgggaattgagctacttgagaaagcgctttcatag

DBGET integrated database retrieval system