KEGG   Pyrococcus furiosus DSM 3638: PF0608Help
Entry
PF0608            CDS       T00075                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PF0608
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PF0608
  Lipid metabolism
   00071 Fatty acid degradation
    PF0608
  Amino acid metabolism
   00350 Tyrosine metabolism
    PF0608
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PF0608
   00626 Naphthalene degradation
    PF0608
Enzymes [BR:pfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PF0608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
630051..631178
Genome map
AA seq 375 aa AA seqDB search
MFFLKTKIIEGRGSLEYLQKEAIGFERALILASSSMKRLGFLKEAEDYLREGGVEVISIA
GLPPEPTKDVVDEFLPKVREFSPEILIAIGGGSVIDMAKALKVFYDVPGISFEEVAIKSR
FSKPRPVPKLKTPLIAIPSTSGAGSEVSAASVIKVGDVKYTIVTPEIAPEVAILDPRLPE
GMPPEVARNSGMDVLVHAIEAYVSKASSPFTDAMAVKAAKAVLEHLEESIRGDKNAREKI
HYAATMAGIAFLNARLGLVHAMSHKAAWIGPHGLVNAILLPYVMEYNMARRREKYDALAR
ELGFDNAEELLEEIKALNERLGIGPISSYVSEEEFLAKLDEMVERAYEDPLVNFNPVEPR
KEDIRRIYERAFYGD
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcctaaagactaagattatcgagggaaggggaagtttggagtatcttcaaaag
gaagctattgggttcgagagggctttaatcttagcgtcaagctctatgaaaaggttaggg
tttctgaaggaagctgaagactatctaagggaaggtggagttgaggtaatttcaatagca
ggccttcctcctgagcccacgaaagacgttgtcgacgagttcctcccaaaagttagggag
ttttctccagagatcctcattgcaattggtggaggaagtgttatcgatatggccaaagct
ctaaaggtattttacgatgtcccaggaatttcatttgaggaagttgcaatcaagagtaga
ttttcgaagccgagacccgttccaaagctgaaaactccccttatagctattccctcaacg
agcggtgctggaagtgaggtttcagcagcgagcgtgattaaggtaggggacgttaagtac
acgattgtaactcccgagatagctcctgaagtggctatacttgaccctagattacccgaa
ggaatgcccccagaagttgccaggaattctggaatggatgttttagttcatgcgatagag
gcttatgtttcaaaggcttcctcaccctttacagatgcaatggcagttaaagcggcaaaa
gctgtgttggagcatttagaggagagcattagaggagacaaaaatgccagagagaaaatc
cactatgcagctacaatggctggcatagctttcttaaacgcaaggcttggactcgttcat
gcgatgagtcataaggccgcatggataggaccgcatggtctcgtaaatgccattctactt
ccctatgtgatggagtataacatggcacgcaggagagagaaatatgatgcattggcgagg
gaattgggatttgacaatgctgaagagctccttgaagagataaaagctctgaacgaaagg
cttggaataggacccatctcaagttacgtcagcgaggaggagttcttagcgaagcttgat
gaaatggtagagagagcctatgaagatcccctcgttaacttcaacccagttgagccgaga
aaagaggacattagaagaatttatgagagggccttctatggagattga

DBGET integrated database retrieval system