KEGG   Pyrococcus furiosus DSM 3638: PF0613Help
Entry
PF0613            CDS       T00075                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PF0613
   01230 Biosynthesis of amino acids
    PF0613
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PF0613
   00030 Pentose phosphate pathway
    PF0613
   00051 Fructose and mannose metabolism
    PF0613
  Energy metabolism
   00680 Methane metabolism
    PF0613
Enzymes [BR:pfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     PF0613
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     PF0613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
634042..635169
Genome map
AA seq 375 aa AA seqDB search
MAVGEKITISVIKADVGGWPGHSRVHPALIERAKEVLSEAQKEGTLIDFYVTYAGDDLQL
IMTHKKGVDSPEIHGLAWEAFKKATEVAKELGLYGAGQDLLKDAFSGNVRGLGPSVAEME
ITLRKSEPIVTFHLDKTEPGAFNLPIFRMFADPFNTAGLVIDPKMHMGFRFEIWDILEHK
RVIMNSPEEMYDILALIGAKSRYVIKRVYPKEGHPIPKDEPVAVVSTEKLYEVAGEYVGK
DDPVAIVRAQSGLPALGEVLEPFAFPHLVSGWMRGSHNGPLMPVPLKYATPTRFDGPPRA
VALGWQISPEGKLIGPVDLFDDPAFDWARQKALEITDYMRRHGPFEPHRLPLEEMEYTTL
PGVLEKLKDRFEPIE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaggagagaagataacaataagcgtgataaaagcagacgtcggagggtggcct
ggccattcaagagttcacccagcacttatagagagggcaaaagaagtactaagcgaagct
caaaaagaaggaaccctcatagacttctatgtaacctacgctggagatgacctccagctt
ataatgactcacaagaagggagttgacagcccagagatccacgggctcgcttgggaagca
ttcaaaaaggccacagaagtggcgaaggaactaggcctatatggagctggacaggacctt
ctaaaggatgcatttagtggtaatgttagaggtctaggtccaagcgttgcagagatggaa
ataacactaagaaagagcgaaccaatagttacattccacttagataagactgaaccagga
gcattcaatctcccaatatttagaatgtttgccgatcccttcaacacagcggggctcgta
atagatccaaagatgcacatgggattcaggttcgagatatgggacattctcgagcacaag
agagttatcatgaactctccagaggaaatgtacgatattctagccctaataggagcaaag
agtaggtacgtcattaagagggtgtatccgaaggaagggcacccaattccaaaagatgaa
cccgttgctgttgtatcaactgaaaagctctacgaagtggcaggagagtatgtaggaaag
gatgatccagtggccatagtaagagcacaaagtggtcttccagccctgggagaagttcta
gaaccatttgcattcccacacttggtcagcgggtggatgagaggtagccacaatggtcca
ctaatgccagttccacttaaatatgcaacaccaacaagattcgacggaccaccaagggct
gtagctttaggatggcagataagcccagaaggaaagctcattggtccagttgacttgttt
gatgacccagcattcgactgggcaagacaaaaggccttggagataactgattacatgagg
aggcatggaccatttgagcctcacagactaccactggaggagatggaatacacaactctc
ccaggagtcctagagaagttaaaggacagatttgaacctatagagtga

DBGET integrated database retrieval system