KEGG   Pyrococcus furiosus DSM 3638: PF0965Help
Entry
PF0965            CDS       T00075                                 

Definition
pyruvate ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PF0965
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PF0965
   00020 Citrate cycle (TCA cycle)
    PF0965
   00620 Pyruvate metabolism
    PF0965
   00640 Propanoate metabolism
    PF0965
   00650 Butanoate metabolism
    PF0965
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PF0965
   00680 Methane metabolism
    PF0965
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PF0965
Enzymes [BR:pfu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PF0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(925374..926369)
Genome map
AA seq 331 aa AA seqDB search
MAVRKPPITTREYWAPGHAACAGCGCATALRLATKALSEAMEEKYGDPNAFAIAHATGCM
EVVSAVFPYTAWKAPWIHVAFENAAAVASGIEAAWKKLGRKGKILAIGGDGGTADIGLQA
LSGMLERWHNVLYLMYDNEAYMNTGIQRSSSTPYGAWTTTSPPGKYSVGEDKPKKWVALI
AAAHQIPYVATASIGNPLDFVRKIKKAGKIDGPAFVQVLCTCPTGWRSPLEKGVEIARLA
IETGIWPLFEIENGDIWNIKIQPPGGGAKVYKEGNRVVRIEFKKPIEEYLKLQGRFKHLF
KRPEAIEELRNQVKAMWKVLGVEAILPRPEE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcagttagaaagcccccaataactacccgtgaatattgggctcctggtcatgccgca
tgtgcaggttgtgggtgtgctactgctctaaggttagctaccaaggctcttagtgaagct
atggaagagaaatatggagatccaaacgccttcgcaatagctcacgcaactggctgtatg
gaagtagtgtcagctgtattcccatatacagcatggaaggccccctggattcacgtagct
tttgaaaacgctgcagccgtagcgagtggtattgaagctgcatggaagaagcttggaagg
aaaggtaagatattggcaataggtggagatggtggtacagctgatataggactccaagcc
ctctctggaatgctcgaaagatggcacaatgttctctaccttatgtatgacaatgaggct
tacatgaacactggaattcagaggtcttcatcaacaccatatggagcatggaccacaact
tcacctcccggaaagtattcagtaggtgaagacaagccaaagaagtgggtagcacttatt
gcagccgctcatcaaattccctatgtagcaactgcaagcataggaaatccacttgacttc
gtgagaaagataaagaaagcaggcaagattgacgggccagcattcgttcaagtcctctgt
acttgtccgacaggatggagaagtccactggaaaaaggcgttgagatagcaaggctagcc
atagaaacaggtatatggccactcttcgagattgaaaatggtgacatctggaacattaag
atacagcccccaggaggaggagctaaggtttacaaggaaggcaacagagtcgttagaata
gagttcaagaagccaatcgaggagtacctcaagctccaaggaagattcaagcacctcttc
aagagaccagaggccattgaagagcttaggaaccaagtaaaagcaatgtggaaagtctta
ggagttgaagcaatacttccaagacccgaggagtag

DBGET integrated database retrieval system