KEGG   Pyrococcus furiosus DSM 3638: PF0966Help
Entry
PF0966            CDS       T00075                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase subunit alpha-2
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
pfu00010  Glycolysis / Gluconeogenesis
pfu00020  Citrate cycle (TCA cycle)
pfu00620  Pyruvate metabolism
pfu00640  Propanoate metabolism
pfu00650  Butanoate metabolism
pfu00680  Methane metabolism
pfu00720  Carbon fixation pathways in prokaryotes
pfu01100  Metabolic pathways
pfu01120  Microbial metabolism in diverse environments
pfu01130  Biosynthesis of antibiotics
pfu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PF0966
   00020 Citrate cycle (TCA cycle)
    PF0966
   00620 Pyruvate metabolism
    PF0966
   00640 Propanoate metabolism
    PF0966
   00650 Butanoate metabolism
    PF0966
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PF0966
   00680 Methane metabolism
    PF0966
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PF0966
Enzymes [BR:pfu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PF0966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C DXP_redisom_C DUF4290 PRA-PH
Motif
Other DBs
NCBI-ProteinID: AAL81090
UniProt: Q51804
Position
complement(926380..927570)
Genome map
AA seq 396 aa AA seqDB search
MPIRKVMKANEAAAWAAKLAKPKVIAAFPITPSTLIPEKISEFVANGELDAEFIKVESEH
SAISACVGAAAAGVRTFTATASQGLALMHEILFIAAGMRLPIVMAIGNRALSAPINIWND
WQDTISQRDTGWMQFYAENNQEALDLILIAYKVAEDERVLLPAMVGFDAFILTHTVEPVE
IPDQEVVDEFLGEYEPKHAYIDPARPITQGSLAFPAHYMESRYTVWEAMERAKKVIDEAF
AEFEKKFGRKYQKIEEYKTEDADIIFVTMGSLAGTLKEWIDKKREEGYKVGAAKITVYRP
FPVEEIRELAKKAKVLAFLEKNITIGLYGAVFTDASAALINESEKPLMVDFIVGLGGRDV
TFNQLDEALEIAEKALKEGKVENPINWIGLRWELVK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgccaattaggaaagttatgaaggctaatgaagccgctgcttgggctgctaagttggct
aaaccaaaggttatagcagcattcccaattacaccttcaaccctaatacccgagaagatt
agtgaattcgtggcaaatggtgaactagacgcagagtttattaaagttgaaagtgagcac
tcagcaatttcagcatgtgtaggtgcggctgctgcaggtgttagaaccttcacagcaaca
gcctctcaaggtttggctttaatgcacgaaattctattcattgctgctggcatgagattg
ccaattgtaatggcaattggtaacagagctttgtcagctccaattaacatctggaatgac
tggcaagacacaattagccaaagagatactggatggatgcagttctatgcagaaaacaac
caagaggctctagacttgatcctaatagcttacaaagttgcagaagatgaaagagtcctc
cttccagccatggttggattcgatgcattcatcctaacccatacagttgaaccagtagaa
atcccagaccaagaggttgttgatgaattcctaggagaatacgagcccaagcacgcatat
attgatcccgcaaggcctataactcaaggaagccttgcattcccggcccactatatggag
agcagatacacagtttgggaggctatggagagagcaaagaaggtaatagacgaagcattt
gcagaattcgagaagaagttcggaagaaagtaccagaagattgaggagtacaagacagag
gatgcagacataatcttcgtaacaatgggttcactggctggaacccttaaagagtggata
gacaagaagagagaggaaggttacaaagtcggtgcagcaaagataaccgtttataggcca
ttcccagtagaagagataagagaactagcaaagaaggcaaaggttctcgcattcctagag
aagaacatcacaatcggcctttatggtgcagtctttacggatgcatcagcagctctcatc
aacgagagcgaaaagccactaatggtcgacttcatagttggcctaggtggaagagatgta
accttcaaccagcttgacgaagccctggaaattgcagagaaggcactcaaggaaggtaaa
gttgagaatccaattaactggattggattaagatgggaacttgtgaagtga

DBGET integrated database retrieval system