KEGG   Pyrococcus furiosus DSM 3638: PF0967Help
Entry
PF0967            CDS       T00075                                 

Gene name
porD
Definition
pyuvate ferredoxin oxidoreductase subunit delta (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PF0967 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PF0967 (porD)
   00020 Citrate cycle (TCA cycle)
    PF0967 (porD)
   00620 Pyruvate metabolism
    PF0967 (porD)
   00640 Propanoate metabolism
    PF0967 (porD)
   00650 Butanoate metabolism
    PF0967 (porD)
  Energy metabolism
   00680 Methane metabolism
    PF0967 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PF0967 (porD)
Enzymes [BR:pfu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PF0967 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(927581..927898)
Genome map
AA seq 105 aa AA seqDB search
MAESPFKADIERAQKELSEKMTPGAIVYIPGSSVINKTGSWRVFKPEFNRDKCVRCYLCY
IYCPEPAIYLDEEGYPVFDYDYCKGCGICANECPTKAIEMVREVK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaagtccgtttaaggccgatatagaaagagcccaaaaagagttaagtgaaaaa
atgacacccggagcaatagtctacattccaggaagtagcgtcattaataaaactggatct
tggagagtttttaagccagagttcaacagggacaagtgtgtaaggtgttatctctgctac
atctactgtccagagcctgcaatatacctagatgaagaaggttacccagtttttgactac
gactattgtaagggttgtggaatctgtgctaatgagtgtccaacaaaagccattgaaatg
gttagagaagttaagtga

DBGET integrated database retrieval system