KEGG   Pyrococcus furiosus DSM 3638: PF0967Help
Entry
PF0967            CDS       T00075                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase subunit delta
  KO
K00171  
pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PF0967
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PF0967
   00020 Citrate cycle (TCA cycle)
    PF0967
   00620 Pyruvate metabolism
    PF0967
   00640 Propanoate metabolism
    PF0967
   00650 Butanoate metabolism
    PF0967
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PF0967
   00680 Methane metabolism
    PF0967
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PF0967
Enzymes [BR:pfu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PF0967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(927581..927898)
Genome map
AA seq 105 aa AA seqDB search
MAESPFKADIERAQKELSEKMTPGAIVYIPGSSVINKTGSWRVFKPEFNRDKCVRCYLCY
IYCPEPAIYLDEEGYPVFDYDYCKGCGICANECPTKAIEMVREVK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaagtccgtttaaggccgatatagaaagagcccaaaaagagttaagtgaaaaa
atgacacccggagcaatagtctacattccaggaagtagcgtcattaataaaactggatct
tggagagtttttaagccagagttcaacagggacaagtgtgtaaggtgttatctctgctac
atctactgtccagagcctgcaatatacctagatgaagaaggttacccagtttttgactac
gactattgtaagggttgtggaatctgtgctaatgagtgtccaacaaaagccattgaaatg
gttagagaagttaagtga

DBGET integrated database retrieval system