KEGG   Pyrococcus furiosus DSM 3638: PF1004Help
Entry
PF1004            CDS       T00075                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pfu00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pfu00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pfu02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
961264..962748
Genome map
AA seq 494 aa AA seqDB search
MKKITISSLLLLLLISTNLNLAYDSQESGIKNIIILIGDGMGMSHVQITKLVYGHLNMEE
FPIIGFELTESLSGEVTDSAAAGTAIATGVKTYNRMISVTNITGKVTNLTTLLEIAQVLG
KSTGLVTTTRITHATPAVFASHVPDRDMEEEIARQLIAHRVNVLLGGGRKKFDENTLKMA
KEQGYNIVFTKEELEKAEGEFILGLFADSHIPYVLDRKPEDVGLLEMTKKAISILEKNPN
GFFLMIEGGRIDHAAHENDIASVVAETKEFDDVVGYVLEYAKKRGDTLVIVLADHETGGL
GLGLTYGDAINEDVIRNINASVSKIASEIRATNDIKRVIKKYTGFELTEDEINYIEEAIN
LADEYALQNAIADIINKRVGVGFVSHKHTGAPVSLLAYGPGAENFAGFLHHVDTAKLIAK
LMLFGKKDIPVTILGISGVKGDITGDFKVDEQDAYVTLMMLLGERVDTELERKVDMNNNG
IIELGDVLLILQES
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaataactattagtagtttgcttctacttttacttatttctaccaatttgaat
ctcgcatacgattcccaagagagcggtattaaaaatataataatcctcattggagacggc
atgggaatgagtcatgtccagattacaaagcttgtttatggtcatctaaacatggaagag
ttcccaattattggattcgaacttactgagtcattaagtggggaagttacggactccgct
gcagcaggaactgcaatagcaactggagtcaaaacatataatcgaatgatttcagttact
aacataactggaaaagttacaaatctaactaccttgcttgaaatagcccaggtacttgga
aaatcaactggacttgtgactactactagaattacacacgcaacccctgcagtatttgct
tcccacgttcctgacagagatatggaagaggaaatagcgagacagctcatagctcaccgg
gtcaacgtcctattaggtggagggagaaagaaatttgacgagaataccctaaaaatggca
aaagaacagggatataatatagtcttcacgaaagaagagctcgagaaagcagagggtgag
tttattctagggctttttgcagatagccacattccttacgtattggacagaaaaccagaa
gatgttggacttttggaaatgactaaaaaagcaatttcaatactagagaaaaatccaaat
gggttctttctcatgattgaagggggcagaattgatcatgcagctcatgagaatgatata
gcatcagttgttgcagagactaaggagtttgatgacgttgttggatatgttcttgagtat
gcaaaaaagaggggagatacactagtaatagtgctggctgaccatgagacaggggggctt
ggattaggtctaacatatggagatgcaattaatgaagatgtcatcaggaacataaacgct
agtgtgtcgaaaattgctagtgaaataagggcaacgaatgacataaagagagttatcaaa
aaatatactggattcgagctaacagaggacgaaattaattacattgaggaagctataaac
ttagcagacgaatatgcgcttcaaaatgcaatagctgatattataaacaaacgcgttggt
gtaggttttgtatcccacaaacatacaggagctcctgtttcacttctagcctacggccca
ggtgcagagaattttgcaggctttttacaccatgtagatacggcaaagctaattgccaag
ctaatgctctttgggaagaaagatattcccgttaccatcttgggaataagtggagttaaa
ggagatataaccggagacttcaaagtggatgagcaagatgcatatgtgaccttaatgatg
ttgcttggggaaagggtagatactgaacttgaaaggaaagtcgacatgaataataacggc
ataatcgagttgggagacgtgctcctgattctacaagagtcctaa

DBGET integrated database retrieval system