KEGG   Pyrococcus furiosus DSM 3638: PF1055Help
Entry
PF1055            CDS       T00075                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PF1055
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PF1055
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PF1055
Enzymes [BR:pfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PF1055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1009071..1010255
Genome map
AA seq 394 aa AA seqDB search
MVLKCVVCGREYPEDEVRYRCECGGLLEVVIDLDKVDTSIFNGKEIKLWKYESWLPVKKR
VSLEEGGTPLYRLLNLESDLGVKELYAKNEGANPTGSFKDRGMTVGVSKALELGMDKVIC
ASTGNTSASLAAYAAKAGIKAYVLIPSGKIALGKLAQAIIYGARVVPIKGNFDDALRVVV
ETSKELGIYMLNSINPFRLEGQKTIAYEIYDQLGKVPDNVILPVGNAGNISAIWKGFKEM
YEAGVIDELPRMIGIQAEGASPLAKAWKEKRKFQPEESPETIASAIRIGNPANWIKAWRA
VEESGGLFESVSDEEILRAQKLLASREGLFVEPASAASLAGLIKLLESGEISRNESYVLI
TTGHGLKDPNIVIKNFQVPEPIDPTLEAFKEVIE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgaaatgtgtagtctgtgggagagagtatcctgaagacgaagttaggtatagg
tgtgagtgtggaggtctattagaggttgttatcgatctagataaagttgatacttccatt
tttaacggtaaggagataaagctgtggaaatatgaaagctggctacccgtaaagaagaga
gttagtctggaagaaggtggaactcccctatataggttattaaatcttgaaagtgatctt
ggagtaaaagagctctatgcaaaaaacgagggtgcgaatccaacaggttcatttaaagac
cgcggaatgacggttggagtctcgaaggctcttgagctaggaatggataaagtcatatgt
gcatctacgggaaatacttcagcatcacttgctgcttatgctgcaaaagcaggaataaaa
gcatatgtcctaatcccaagtgggaagatagcgttaggaaagcttgctcaagcaataatc
tatggggctagggttgtaccaatcaaggggaactttgacgatgctctaagagtagtcgtg
gagacaagcaaagaacttgggatatacatgttaaattcaataaacccattcaggctcgaa
ggacaaaagacaatagcgtatgagatatatgaccaacttggaaaagttccagacaacgtt
attctcccagttggaaatgcaggaaacatttctgcaatatggaaggggtttaaggagatg
tatgaggctggcgtaatagatgaacttcccaggatgataggaattcaagcagaaggagca
tccccattagcgaaggcttggaaagagaaaagaaaattccaacccgaagagagtccagaa
accattgcatcggccataagaataggaaaccccgcaaattggataaaggcatggagggct
gttgaagaatctgggggactatttgagagcgtaagtgatgaggaaatactaagagctcag
aaacttctagcgtctagggaaggactatttgttgaacctgcttctgcagcatctttagct
ggcttaattaagctccttgaaagtggtgaaataagcaggaatgagagttacgttttaatc
acaactggacatgggctaaaagatccaaatatcgtcataaagaacttccaagttccagaa
cctatagacccaactttagaagcttttaaggaggtgattgaatga

DBGET integrated database retrieval system