KEGG   Pyrococcus furiosus DSM 3638: PF1055Help
Entry
PF1055            CDS       T00075                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PF1055
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PF1055
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PF1055
Enzymes [BR:pfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PF1055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1009071..1010255
Genome map
AA seq 394 aa AA seqDB search
MVLKCVVCGREYPEDEVRYRCECGGLLEVVIDLDKVDTSIFNGKEIKLWKYESWLPVKKR
VSLEEGGTPLYRLLNLESDLGVKELYAKNEGANPTGSFKDRGMTVGVSKALELGMDKVIC
ASTGNTSASLAAYAAKAGIKAYVLIPSGKIALGKLAQAIIYGARVVPIKGNFDDALRVVV
ETSKELGIYMLNSINPFRLEGQKTIAYEIYDQLGKVPDNVILPVGNAGNISAIWKGFKEM
YEAGVIDELPRMIGIQAEGASPLAKAWKEKRKFQPEESPETIASAIRIGNPANWIKAWRA
VEESGGLFESVSDEEILRAQKLLASREGLFVEPASAASLAGLIKLLESGEISRNESYVLI
TTGHGLKDPNIVIKNFQVPEPIDPTLEAFKEVIE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgaaatgtgtagtctgtgggagagagtatcctgaagacgaagttaggtatagg
tgtgagtgtggaggtctattagaggttgttatcgatctagataaagttgatacttccatt
tttaacggtaaggagataaagctgtggaaatatgaaagctggctacccgtaaagaagaga
gttagtctggaagaaggtggaactcccctatataggttattaaatcttgaaagtgatctt
ggagtaaaagagctctatgcaaaaaacgagggtgcgaatccaacaggttcatttaaagac
cgcggaatgacggttggagtctcgaaggctcttgagctaggaatggataaagtcatatgt
gcatctacgggaaatacttcagcatcacttgctgcttatgctgcaaaagcaggaataaaa
gcatatgtcctaatcccaagtgggaagatagcgttaggaaagcttgctcaagcaataatc
tatggggctagggttgtaccaatcaaggggaactttgacgatgctctaagagtagtcgtg
gagacaagcaaagaacttgggatatacatgttaaattcaataaacccattcaggctcgaa
ggacaaaagacaatagcgtatgagatatatgaccaacttggaaaagttccagacaacgtt
attctcccagttggaaatgcaggaaacatttctgcaatatggaaggggtttaaggagatg
tatgaggctggcgtaatagatgaacttcccaggatgataggaattcaagcagaaggagca
tccccattagcgaaggcttggaaagagaaaagaaaattccaacccgaagagagtccagaa
accattgcatcggccataagaataggaaaccccgcaaattggataaaggcatggagggct
gttgaagaatctgggggactatttgagagcgtaagtgatgaggaaatactaagagctcag
aaacttctagcgtctagggaaggactatttgttgaacctgcttctgcagcatctttagct
ggcttaattaagctccttgaaagtggtgaaataagcaggaatgagagttacgttttaatc
acaactggacatgggctaaaagatccaaatatcgtcataaagaacttccaagttccagaa
cctatagacccaactttagaagcttttaaggaggtgattgaatga

DBGET integrated database retrieval system