KEGG   Pyrococcus furiosus DSM 3638: PF1071Help
Entry
PF1071            CDS       T00075                                 

Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PF1071
Enzymes [BR:pfu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PF1071
Peptidases [BR:pfu01002]
 Cysteine Peptidases
  Family C44
   PF1071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1021338..1022753
Genome map
AA seq 471 aa AA seqDB search
MCLITGGINLTKEEIVKMIITGKHRGPDSFGVWSDGLVIKSEDFSEIKEIRGGNVVLAQC
RLAMTGSKNYTQPFYNDIVLVHNGEIYNHESLRKWLIERGASFESDVDSEVILRLLEYFI
FDKKMKVEEAVKKAMLMLRGDYAVAFALNGKIYLFRDPIGVRPLYYSPRGRFGSEKKVLW
SVGEEAIPVNPGELVKLPEEEKMKLLSPWDIKGSGKGYYDGLKNLLQDAVRIRTAKKVGV
LFSGGLDSSLIALLASKYSKVVLYTAGTEDSKDVEWARKVSDELRLELREYIFTREEVER
EIKNVMFAIEEPNPMNLAIAIPLYFATKLARKDDVKVLLSGQGADELFGGYAKYLENPSL
MRKDIEEIAERNLGRDDKVGMLNGVEVRYPYLDLPFVSLALRVPLEEKIREGVRKAILRR
IALDFGLPEEVAFREKKAAQYGSNAQKILSKIAKKSLREFAQKLFSEVFST
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtgtctaataaccggaggaataaatctaacaaaggaagaaatcgtcaagatgataatt
actggaaagcatagaggaccagattcttttggcgtatggagcgatgggttagttataaaa
tctgaggacttctcagagataaaagaaattagagggggcaacgttgttttagcccagtgt
aggcttgcaatgactggatctaaaaactatacccaacccttttacaatgacattgttctc
gtccacaatggagagatatataaccacgaaagtttgaggaagtggttaatagagagggga
gcatcatttgagagtgacgtggacagtgaggttatcctaagacttttggagtattttata
tttgacaaaaagatgaaagttgaggaggccgttaaaaaagcgatgcttatgttgagggga
gactacgccgtcgcatttgctctcaatggtaaaatctatttgtttagggatcctattgga
gttagaccactctactattccccaagggggaggtttgggtcagagaagaaggtgttgtgg
agtgtaggtgaagaagcaataccagttaacccaggtgagctcgttaagttgccagaagaa
gagaagatgaagctactttccccctgggacattaaaggttctggaaaaggatactacgac
ggtcttaagaatttacttcaagatgctgtaagaataaggacagctaaaaaagttggagtg
ctcttttcaggaggattggacagctcattaatagctttgttagcttcaaaatactctaag
gtagttctctacactgcgggaacggaggatagtaaagacgttgagtgggccagaaaagtt
agtgatgagcttagacttgagcttagagagtatatatttacccgggaggaagttgagagg
gagattaagaatgtaatgttcgctatagaggagccaaatccaatgaacttagccattgca
attcctctatattttgccacaaagcttgctaggaaggatgatgttaaggtccttttgagt
ggccagggtgctgatgaactgtttggaggatatgcaaagtatctcgagaatccctctttg
atgagaaaagatatagaggagatagccgagagaaacttaggtagagatgataaagtggga
atgctaaatggtgtggaagttagatacccctacttggatttgccctttgtctctctagcc
ttaagggttcccctagaagaaaagataagagagggagttagaaaggcaattttgaggaga
attgcactagattttggcttgccagaagaagttgcctttagggagaaaaaggccgcacaa
tacgggagcaatgctcagaagatactctctaagatagcaaagaagagtcttagagaattc
gcccagaagttattttctgaggtattctctacataa

DBGET integrated database retrieval system