KEGG   Pyrococcus furiosus DSM 3638: PF1105Help
Entry
PF1105            CDS       T00075                                 

Definition
pyrazinamidase/nicotinamidase pxnc
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:pfu00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1052537..1053073
Genome map
AA seq 178 aa AA seqDB search
MPEEALIIVDMQRDFMPGGALPVPEGDKIIPRINDYIKEFKEKGALIVATRDWHPENHIS
FKERGGPWPKHCVQNTPGAEIVVDLPEDAIIISKATEPDKEAYSGFEGTNLAEILKKNGV
KRVYICGVATEYCVRATALDALKHGFEVYLLKDAVKGINPEDEKKVLRELEEKGVKIL
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggaagccctcattattgttgacatgcaaagagacttcatgcccggtggggct
cttccagtacctgaaggtgacaaaataattcccagaataaatgactacataaaagaattc
aaggagaagggagctttgatagttgcgacgagagactggcaccctgaaaatcatataagc
tttaaggaaagaggtggaccatggccaaagcactgtgttcagaataccccaggagcggag
atagtggtcgatcttccggaggatgcaataataatttcaaaggccactgagccagataag
gaggcgtattcaggatttgaggggactaacttagctgagatcctcaagaagaatggcgta
aagagggtttacatctgcggtgttgcaactgaatactgtgtgagagctacggccttagat
gccctaaagcatggtttcgaagtttatcttctcaaagatgccgtgaagggaataaacccc
gaagacgaaaagaaagtcctgagggagttagaggagaaaggagttaagattctctag

DBGET integrated database retrieval system