KEGG   Pyrococcus furiosus DSM 3638: PF1203Help
Entry
PF1203            CDS       T00075                                 

Definition
formaldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pfu01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pfu00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1143520..1145403
Genome map
AA seq 627 aa AA seqDB search
MNVKMVDSMYGWWGRILRVNLTTGEVKVQEYPEEVAKKFIGGRGLAAWILWNEARGVEPL
SPENKLIFAAGPFNGLPTPSGGKLVVAAKSPLTGGYGDGNLGTMASVHLRRAGYDALVVE
GKAKKPVYIYIEDDNVSILSAEGLWGKTTFETERELKEIHGKNVGVLTIGPAGENLVKYA
VVISQEGRAAGRPGMGAVMGSKKLKAVVIRGTKEIPVADKEELKKLSQEAYNEILNSPGY
PFWKRQGTMAAVEWCNTNYALPTRNFSDGYFEFARSIDGYTMEGMKVQQRGCPYCNMPCG
NVVLDAEGQESELDYENVALLGSNLGIGKLNEVSVLNRIADEMGMDTISLGVSIAHVMEA
VERGILKEGPTFGDFKGAKQLALDIAYRKGELGNLAAEGVKAMAEKLGTHDFAMHVKGLE
VSGYNCYIYPAMALAYGTSAIGAHHKEAWVIAWEIGTAPIEGEKAEKVEYKISYDPIKAQ
KVVELQRLRGGLFEMLTACRLPWVEVGLSLDYYPKLLKAITGVTYTWDDLYKAADRVYSL
IRAYWVREFNGKWDRKMDYPPKRWFTEGLKSGPHKGEHLDEKKYDELLSEYYRIRGWDER
GIPKKETLKELDLDFVIPELEKVTNLE
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaaagatggtggattctatgtatggatggtggggtaggattctaagggtaaac
ctaacaactggagaagttaaggttcaggaataccccgaagaagttgccaagaaatttatt
ggaggtagaggattagccgcctggattctttggaatgaagctagaggtgttgagcccctt
agtccagaaaacaagttaatctttgctgctggtcccttcaatggccttccaaccccgagc
ggtggaaagcttgtagttgcggctaagagtcctctaactggaggttatggtgacggcaac
ctaggaacaatggcttctgttcacttgagaagggcaggttatgatgctctcgttgttgaa
ggtaaggcaaagaagcccgtctacatttatatcgaagatgacaacgttagcatccttagt
gctgaaggtctatggggtaagacaacattcgagaccgagagagaattaaaggaaatccat
ggcaagaacgtcggcgttttaaccatcggaccagccggagaaaatttagttaaatatgct
gttgttatctcccaggagggaagagctgctggaagacctggaatgggtgctgtaatggga
agcaagaagttaaaggccgtagtaataaggggaaccaaggagataccagttgcagacaag
gaagagttaaagaagctcagccaggaggcatataatgaaattctaaactctccagggtat
ccattctggaagagacaggggaccatggcagctgtagagtggtgtaatactaactatgcc
ctcccaacaaggaacttcagcgatggctacttcgaattcgctcgttcaatagatggttac
acaatggaggggatgaaggtacagcagaggggctgtccctactgtaacatgccgtgtgga
aatgtagtgcttgatgcagagggccaagagagtgagcttgactatgaaaatgtagccttg
ctgggttcaaaccttggaatagggaagcttaacgaggtttcagttctcaacaggatagct
gacgagatgggtatggacacgataagcctcggtgtttcaatagcccacgtaatggaggct
gtggagagaggaatcctcaaggaagggccaacatttggagacttcaagggagctaagcaa
ttggccttggatatagcttacagaaaaggagagctcggcaacttagctgcagagggagtt
aaggctatggccgagaagcttggaactcatgatttcgcaatgcacgttaagggattagag
gttagtggttacaactgttacatctacccagcaatggcattagcttatggaacgagcgca
atcggtgcacaccacaaggaggcatgggttattgcatgggaaatcggtactgccccaatt
gaaggagagaaggccgagaaggtggagtacaagataagttacgatccaataaaggcccag
aaagttgttgagttgcagaggttgagaggtgggctcttcgagatgcttacggcatgtagg
ctaccatgggttgaggttggcctaagcctagactactatccaaagctcctcaaggcaata
actggagtcacctacacctgggatgacctttacaaggcagctgacagggtttattccctc
ataagagcttattgggtgagagaattcaacggcaagtgggatagaaagatggattaccca
ccaaagagatggttcacagagggactgaagagtggcccgcacaagggagagcacctcgat
gagaagaagtacgatgagttgctctcagagtactacagaataaggggatgggacgagaga
ggaattccaaagaaggaaactttgaaagagcttgacctcgacttcgtaattcctgagctg
gagaaggttacaaaccttgagtga

DBGET integrated database retrieval system