KEGG   Pyrococcus furiosus DSM 3638: PF1265Help
Entry
PF1265            CDS       T00075                                 

Definition
nol1-nop2-sun family nucleolar protein II
Orthology
K03500  
16S rRNA (cytosine967-C5)-methyltransferase [EC:2.1.1.176]
Organism
pfu  Pyrococcus furiosus DSM 3638
Brite
Enzymes [BR:pfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.176  16S rRNA (cytosine967-C5)-methyltransferase
     PF1265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1197174..1198526)
Genome map
AA seq 450 aa AA seqDB search
MELFYRVTIHEIVADALMLVEEKELSSKHALEKIFKKVEGKDKEKARGIAHAYVFEIEKW
RAKIDFIINSVLRGSKVEDLDPYLANLLRIGVFEMKFKKINPAIATDSIVRVVKEKFDLT
RAKFANAILREVEKFNVEKALKRLKEKDRIEWLAVRFSHPRWYVEYVIDLLGYDEAVRLL
LSNLKPQRYYVRINSLKADIEKVKKYLEENGVRVAYTPVDDVLKVLEYEKPITKLEGYKK
GYFVIQDLASAYVAHVLSPEPGERVLDLAAAPGSKTFHAAALMENKGEIVAVDYSYERLV
RMKERMKKLGVKNVKLVYADGQSYIDKEKFDKIILDAPCSSSGTYRQFPEVKWRFNEEKI
KRIISVQRNMLINAFRNLKEGGEMTYSTCSVRIDENEENVMFGLERGFEIVDYPFSWGDK
GFLEIGDKTFRTWTHRHDCNSFFIAKLRKP
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggagttattttatcgagtcacaatacatgagatagtcgctgatgctctaatgttggta
gaggagaaagaactttcatctaagcatgctctggaaaaaattttcaaaaaagttgaaggc
aaagataaggagaaggctagaggaatagctcatgcttatgtcttcgaaattgaaaagtgg
agagccaaaatagattttatcataaactctgttcttaggggatcaaaagttgaagattta
gatccttatctagcaaatctccttcgaattggagtttttgaaatgaaatttaaaaagata
aatccagcaattgcgactgattccatagttcgggttgttaaggaaaagtttgacttaact
cgggctaaatttgcaaacgctattctcagggaagttgagaagttcaacgttgagaaggcc
ttaaagcggctaaaagagaaggacagaatagaatggttagccgttaggttctcccatccc
aggtggtatgtagagtatgtaatagacctacttggctatgatgaggcagttagactcctc
ctaagcaatttaaagcctcaaaggtattatgtgaggataaattccctaaaagctgatatt
gaaaaagtaaagaaatacctagaagagaacggggtaagagtagcatatactcctgtagat
gatgttctcaaggttctagaatatgaaaaacccataacaaagttagaagggtacaagaaa
ggatacttcgtcattcaagacttagcatctgcatatgtagcccatgttttgagtcctgaa
cctggagaaagagtgctagacttagcagcagctcctggaagcaaaacattccatgctgcc
gctttaatggagaacaagggggagattgtggcagtggactattcctatgaaagactagtt
agaatgaaggaaagaatgaagaagcttggagttaaaaatgtcaagcttgtttatgcagat
gggcaaagttatattgacaaagaaaagtttgataagataattctcgatgccccctgttct
tcttctggcacctacaggcagtttccagaagtaaagtggaggtttaatgaagaaaaaata
aaaaggataatcagtgttcaaaggaacatgctcataaatgcttttagaaacctcaaagaa
ggtggagaaatgacgtattccacatgttcggtgagaatagacgaaaatgaggaaaatgta
atgttcggcttagaaagaggttttgaaatagtggattatcccttctcctggggagataag
ggatttttagaaatcggggataaaacgtttagaacttggactcatagacatgactgcaac
agctttttcatagcaaagctaagaaaaccttga

DBGET integrated database retrieval system