KEGG   Pyrococcus furiosus DSM 3638: PF1296Help
Entry
PF1296            CDS       T00075                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pfu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1222581..1223405
Genome map
AA seq 274 aa AA seqDB search
MKFAGVSLDTPKVMGVINVSPESFFKGSVKRGEELIETAVRMVEEGAAFIDIGAKSTAPY
LETEIPVEEEIRRAVEAIRAIRDAVDVPISIDTTNAKVAEEAIKAGADIVNDVTGLKGDP
EMVKVVKEYDVPVVICAHQENVRNFSDPVHEVIDSLKESLQIAYKNGIEKENIAIDPAIG
FFRPEYPPWYVWDSKVIANLKLLKVFGLPILVGISRKSFIGAITGREDPSERLEGSLAAT
AIAVLNGANIIRAHDVKETLDVIKVADFIRRFTL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgctggagtttcgttagatactcccaaagtaatgggagtcataaacgtttcc
cctgaaagcttcttcaaggggagtgtgaagagaggagaagagcttatagaaacagcggta
agaatggttgaagagggggcggcgtttatagatattggcgcaaaatcaactgctccctac
ttagaaactgagataccagttgaagaggaaattagaagggccgttgaagctataagagct
attagagatgctgtagatgtcccgataagtattgacacaactaatgctaaggttgctgag
gaagcaataaaagctggggcagacattgtgaacgatgtaactgggcttaagggagaccca
gagatggttaaagttgttaaagaatatgatgtccccgtcgttatatgtgcacatcaagaa
aatgtaaggaacttttcagatccagttcatgaagtgatagactccttgaaggaaagtctt
cagatagcatacaaaaacgggatagagaaagagaacatagcaatagacccagccatagga
tttttcaggcccgaatatcctccctggtatgtttgggattcgaaggtaatagcgaattta
aagttactgaaagtctttggacttccaattttagttggaatatcaaggaagtcattcatt
ggagctataacgggaagggaggatccaagtgaaaggcttgaaggaagcttggccgctacg
gcgatagctgtgttaaatggagcaaacataataagagctcatgacgtcaaagaaacccta
gatgtaataaaggttgcagacttcattcggagattcactctatag

DBGET integrated database retrieval system