KEGG   Pyrococcus furiosus DSM 3638: PF1356Help
Entry
PF1356            CDS       T00075                                 

Definition
glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PF1356
   00052 Galactose metabolism
    PF1356
   00500 Starch and sucrose metabolism
    PF1356
   00520 Amino sugar and nucleotide sugar metabolism
    PF1356
Enzymes [BR:pfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PF1356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1274356..1275207
Genome map
AA seq 283 aa AA seqDB search
MKVRKAVIPAAGLGTRMLPLTKAQPKEMLPVVRKPTIQYVLEEAYEAGIREVLIITGKHK
RAIEDHFDRYEHEVKNPHLDKLDKILDDINIYYARQRVQRGLGDAIKYAEAFVGDEPFAL
LLGDTITLPSCTAGIIESYEELKAPVIAVEEVQEEKISLYGVVGIGRYINERIFEINKLV
EKPEIHEAPSNLAILGRYILTPEIFEYLEEVKPDKKGEIQLTDALELMVQNGKKIYGYVF
KGRRYDIGNIFDWLRANIELGLEDEELSEKLRELIKSLVGERI
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtgagaaaagcggtaattccagcagcaggccttggaacaagaatgttaccactg
actaaagcacaaccaaaagaaatgctccctgttgtgagaaagccaactatccaatatgtt
ctcgaagaagcttatgaggctgggatacgagaagttttgataataacgggaaaacataag
agggcaatcgaagatcatttcgatagatatgagcatgaagtgaaaaatccacatcttgac
aaattggataaaatcctcgatgatataaatatctactatgctagacagagagtacaaagg
ggattgggggatgctatcaaatatgcagaggctttcgttggcgatgaaccctttgctctc
ctcttgggggatactattacactcccttcttgtactgctggaataatagaatcctatgaa
gaattaaaggccccggtaatcgctgtggaagaagttcaagaggagaaaatttctctctat
ggagttgttgggatagggagatatattaatgaaagaatatttgagataaacaagctagtt
gaaaagccagaaattcacgaagctccatcaaatttggccattttaggaaggtacatttta
acccccgaaatctttgagtatttggaggaggtaaagcctgataaaaagggagaaatacag
ctcacagatgctctagagttaatggttcagaatgggaagaaaatttacggctatgtgttt
aagggcaggcgttatgacattggtaacatttttgattggctacgggcaaatattgaatta
ggattagaagatgaagaacttagtgaaaagctaagagaacttatcaaatcgttagtgggg
gaaagaatatga

DBGET integrated database retrieval system