KEGG   Pyrococcus furiosus DSM 3638: PF1540Help
Entry
PF1540            CDS       T00075                                 

Definition
(GenBank) acetyl coenzyme A synthetase (ADP forming)
  KO
K01905  acetate---CoA ligase (ADP-forming) subunit alpha [EC:6.2.1.13]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
pfu00010  Glycolysis / Gluconeogenesis
pfu00620  Pyruvate metabolism
pfu00640  Propanoate metabolism
pfu01100  Metabolic pathways
pfu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PF1540
   00620 Pyruvate metabolism
    PF1540
   00640 Propanoate metabolism
    PF1540
Enzymes [BR:pfu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     PF1540
Lipid biosynthesis proteins [BR:pfu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PF1540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Succ_CoA_lig CoA_binding_2 CoA_binding NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AAL81664
UniProt: E7FI45
Position
1439252..1440640
Genome map
AA seq 462 aa AA seqDB search
MSLEALFNPKSVAVIGASAKPGKIGYAIMKNLIEYGYEGKIYPVNIKGGEIEINGRKFKV
YKSVLEIPDEVDMAVIVVPAKFVPQVLEECGQKGVKVVPIISSGFGELGEEGKKVEQQLV
ETARKYGMRILGPNIFGVVYTPAKLNATFGPTDVLPGPLALISQSGALGIALMGWTILEK
IGLSAVVSVGNKADIDDADLLEFFKDDENTRAILIYMEGVKDGRRFMEVAKEVSKKKPII
VIKAGRSERGAKAAASHTGSLAGSDKVYSAAFKQSGVLRAYTIGEAFDWARALSNLPEPQ
GDNVVIITNGGGIGVMATDAAEEEGLHLYDNLEELKIFANHMPPFGSYKNPVDLTGMADG
KSYEGAIRDALAHPEMHSIAVLYCQTAVLDPRELAEIVIREYNESGRKKPLVVAIVGGIE
AKEAIDMLNENGIPAYPEPERAIKALSALYKWSKWKAKHKEK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagtttggaggctctttttaatccaaaaagcgtcgcagttataggagcttctgcaaag
cctgggaaaataggatatgcaattatgaaaaatctcatagaatatgggtatgaaggcaaa
atatacccagtaaacatcaaaggcggggaaatagagattaacggaaggaaattcaaagtc
tacaagagcgttcttgagattcctgatgaagtagatatggcagtcattgtagttccagct
aagtttgtccctcaggttctagaggaatgtggtcaaaaaggcgtcaaggtcgtcccaatt
ataagctctggatttggagagctaggagaagaaggaaagaaagtcgagcaacaacttgtc
gaaactgccagaaaatatggaatgaggatccttggtcctaacatcttcggagttgtatac
actccagcaaagcttaatgcaacattcggtccaactgacgttctcccagggccattagca
ctaattagccaaagcggtgcccttggaattgcactaatgggatggacaatactggagaaa
ataggactttcagccgttgttagcgttgggaataaagccgacattgacgatgcagacctt
ctagagttcttcaaggatgatgagaatacgagagctattctaatttacatggaaggtgtg
aaagatggaaggaggttcatggaggtagcaaaagaggttagcaagaagaagccaataatt
gtcattaaagccggaagaagcgagagaggagcaaaagcagccgcttcacacacgggatct
cttgcaggtagtgacaaagtttatagcgcagcatttaagcagagtggagtcttaagagca
tataccattggtgaagcttttgactgggcaagagctttaagcaatctacctgagccacaa
ggagataacgttgtgataatcaccaacggaggaggaattggagtaatggcaactgacgcc
gcagaagaagaaggcttacacctctatgacaaccttgaagagctcaagatattcgcaaac
cacatgccaccatttggaagctataagaatcccgttgacttaactggaatggcagatgga
aagagttatgaaggtgctataagggatgctcttgctcatccagaaatgcactcaatagca
gttctctattgtcagactgccgtccttgatccaagagaactggctgagatagtgataaga
gagtacaacgaaagtggaagaaagaagcctcttgtagttgcaattgtgggtggtatagag
gcaaaagaagccatagacatgctaaacgagaacggaattcctgcatatccagaaccagaa
agggcaataaaggcattatcagcactgtacaagtggagcaagtggaaagcaaaacacaaa
gaaaagtaa

DBGET integrated database retrieval system