KEGG   Pyrococcus furiosus DSM 3638: PF1540Help
Entry
PF1540            CDS       T00075                                 

Definition
ADP forming acetyl coenzyme A synthetase (EC:6.2.1.13)
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pfu00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pfu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pfu00640]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1439252..1440640
Genome map
AA seq 462 aa AA seqDB search
MSLEALFNPKSVAVIGASAKPGKIGYAIMKNLIEYGYEGKIYPVNIKGGEIEINGRKFKV
YKSVLEIPDEVDMAVIVVPAKFVPQVLEECGQKGVKVVPIISSGFGELGEEGKKVEQQLV
ETARKYGMRILGPNIFGVVYTPAKLNATFGPTDVLPGPLALISQSGALGIALMGWTILEK
IGLSAVVSVGNKADIDDADLLEFFKDDENTRAILIYMEGVKDGRRFMEVAKEVSKKKPII
VIKAGRSERGAKAAASHTGSLAGSDKVYSAAFKQSGVLRAYTIGEAFDWARALSNLPEPQ
GDNVVIITNGGGIGVMATDAAEEEGLHLYDNLEELKIFANHMPPFGSYKNPVDLTGMADG
KSYEGAIRDALAHPEMHSIAVLYCQTAVLDPRELAEIVIREYNESGRKKPLVVAIVGGIE
AKEAIDMLNENGIPAYPEPERAIKALSALYKWSKWKAKHKEK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagtttggaggctctttttaatccaaaaagcgtcgcagttataggagcttctgcaaag
cctgggaaaataggatatgcaattatgaaaaatctcatagaatatgggtatgaaggcaaa
atatacccagtaaacatcaaaggcggggaaatagagattaacggaaggaaattcaaagtc
tacaagagcgttcttgagattcctgatgaagtagatatggcagtcattgtagttccagct
aagtttgtccctcaggttctagaggaatgtggtcaaaaaggcgtcaaggtcgtcccaatt
ataagctctggatttggagagctaggagaagaaggaaagaaagtcgagcaacaacttgtc
gaaactgccagaaaatatggaatgaggatccttggtcctaacatcttcggagttgtatac
actccagcaaagcttaatgcaacattcggtccaactgacgttctcccagggccattagca
ctaattagccaaagcggtgcccttggaattgcactaatgggatggacaatactggagaaa
ataggactttcagccgttgttagcgttgggaataaagccgacattgacgatgcagacctt
ctagagttcttcaaggatgatgagaatacgagagctattctaatttacatggaaggtgtg
aaagatggaaggaggttcatggaggtagcaaaagaggttagcaagaagaagccaataatt
gtcattaaagccggaagaagcgagagaggagcaaaagcagccgcttcacacacgggatct
cttgcaggtagtgacaaagtttatagcgcagcatttaagcagagtggagtcttaagagca
tataccattggtgaagcttttgactgggcaagagctttaagcaatctacctgagccacaa
ggagataacgttgtgataatcaccaacggaggaggaattggagtaatggcaactgacgcc
gcagaagaagaaggcttacacctctatgacaaccttgaagagctcaagatattcgcaaac
cacatgccaccatttggaagctataagaatcccgttgacttaactggaatggcagatgga
aagagttatgaaggtgctataagggatgctcttgctcatccagaaatgcactcaatagca
gttctctattgtcagactgccgtccttgatccaagagaactggctgagatagtgataaga
gagtacaacgaaagtggaagaaagaagcctcttgtagttgcaattgtgggtggtatagag
gcaaaagaagccatagacatgctaaacgagaacggaattcctgcatatccagaaccagaa
agggcaataaaggcattatcagcactgtacaagtggagcaagtggaaagcaaaacacaaa
gaaaagtaa

DBGET integrated database retrieval system