KEGG   Pyrococcus furiosus DSM 3638: PF1592Help
Entry
PF1592            CDS       T00075                                 

Definition
(GenBank) tryptophan synthase, subunit beta homolog
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
pfu00260  Glycine, serine and threonine metabolism
pfu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pfu01100  Metabolic pathways
pfu01110  Biosynthesis of secondary metabolites
pfu01130  Biosynthesis of antibiotics
pfu01230  Biosynthesis of amino acids
Module
pfu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PF1592
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PF1592
Enzymes [BR:pfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PF1592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AAL81716
UniProt: Q8U0J5
Position
1486031..1487371
Genome map
AA seq 446 aa AA seqDB search
MKVVLPDGRIPRRWYNILPDLPEPLAPPLDPETNEPVDPKKLERIFAKELVKQEMSTKRY
IKIPEEVRKMYSKIGRPTPLFRATNLEKYLNTPARIYFKFEGATVTGSHKINTALAQAYY
AKKEGIERLVTETGAGQWGTALSLAGALMGIKVRVYMARASYEQKPYRKVLMRIYGAEVF
PSPSENTEIGKRFLSENPNHPGSLGIAISEAIEDVLKDEKARYSLGSVLNHVLMHQTVIG
LEAKQQMEEFEEPDVIIGCVGGGSNFAGLAYPFVKEVLDGDNEYEFIAVEPKAAPSMTRG
VYTYDFGDSGELTPKLKMHTLGHRYHVPPIHAGGLRYHGVAPTLSVLVNNGIVKPIAYHQ
TEVFEAAALFAKLEGIVPAPESAHAIKATIDKAIEAKREGKEIVILFNLSGHGLLDLHGY
EEYLEGRLQDYEPKDLPISNPLNPKP
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtagttcttccagacggtagaatacctaggagatggtataatatactccccgat
ttaccggaacccttagctcccccattggatccagagacaaatgaacccgtagaccccaag
aagttggagaggatatttgcgaaagaactagttaagcaggaaatgagcacaaagagatac
ataaaaattcccgaagaagttagaaagatgtattctaaaatagggaggcctacacctctt
ttcagagctacaaacctcgaaaaatacctaaatactcctgcaaggatttacttcaagttt
gagggagcaacagttacaggaagccacaaaatcaatactgccttagctcaggcatattat
gcaaagaaggaaggaatagagaggctagttactgaaactggagctggtcaatggggaact
gcattgagcttggctggagccttgatgggcattaaggttagagtatatatggcaagagca
agttacgagcagaagccatatagaaaagttttaatgaggatttatggagcagaggtattc
ccaagtcccagcgagaatactgaaataggaaaaagattcctaagtgaaaatccaaaccac
ccaggaagcttaggtattgcaattagtgaggcaatagaagatgtactaaaagatgaaaag
gcaagatactccctaggaagtgttctaaaccacgtactaatgcatcaaacggtaattgga
cttgaagcaaagcagcaaatggaagagtttgaggagcccgatgttataataggatgtgtt
ggtggaggaagcaactttgccggtcttgcttatccctttgtaaaagaagtccttgacgga
gacaatgaatacgaatttatagcagtagagccaaaagctgctccttcaatgactagagga
gtctacacttacgattttggggattctggagagctaacccctaagttaaagatgcatact
cttgggcatagataccatgttccccccatacatgctggaggattaagatatcacggagtt
gcacctactttaagtgtactcgttaacaatggaatcgttaagccaatagcttaccatcaa
acagaagtttttgaagctgcagcgttatttgctaagcttgaaggtattgttccagctcca
gaaagtgcccatgcaataaaggccacaatagacaaagccatcgaggctaagagagaagga
aaagaaattgtcatcttgttcaacttaagcggccacggcctactagatctccatggatac
gaagaatacttggagggaaggctccaagactacgagcctaaagatcttcccatatcaaac
cccttgaatcctaaaccttag

DBGET integrated database retrieval system