KEGG   Pyrococcus furiosus DSM 3638: PF1659Help
Entry
PF1659            CDS       T00075                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PF1659 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    PF1659 (hisD)
Enzymes [BR:pfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PF1659 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1544485..1545612
Genome map
AA seq 375 aa AA seqDB search
MDIEEYVREILKDIRERGLEAIREYSKKFDGYEGPFEVSKEEFKEAEERIPERDKEIIKR
TLKRIEKYHRKQLKQDILYIENGSLYGLIYKPLKRIGIYVPGGKPLPSTLMMVGVPARVA
GVKEIVVTNPPKDGKVNPYILYIAKLLKIEEVYKLGGIQAIAAMAYGIGMKKVQKIFGPG
NKFVNEAKRQVFGIVGIDSLAGPSEIAVIADESADKDFVLYDLLSQLEHGKDSKAWLLTT
SKELADYCNREGITVIVCSSLEECCKKANEIAPEHLEIITREPLKLVDLIENAGAIYLGL
YTPVPAADYFLGVNHVLPTGGAAKFMGVLTVWDFMKPISIAMVSREEFISERELGIRLAE
IEGIELHKKSLEVRK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggacattgaagaatacgtcagggagattttgaaagatatccgggaaagaggattagag
gcaataagagagtactcaaaaaaattcgacggatatgaaggcccatttgaagtctcaaag
gaggagtttaaggaagctgaagaaagaattccagaaagggataaagaaattataaagaga
actctcaagagaattgagaaataccatagaaaacaactaaagcaggacattttatacatc
gagaatggctctctctatgggctaatatacaagccactcaagagaatagggatatatgtc
ccaggtgggaaaccgctgccttcaactctaatgatggtaggagtccccgcaagggtcgct
ggagttaaggaaatcgttgtaacaaacccacccaaagatgggaaagtaaatccatacatc
ctgtacatagcaaaactcctcaagattgaagaagtatacaagctcggaggaattcaggca
atagctgccatggcttatggtattggaatgaaaaaggtccaaaagatctttgggcctggg
aataagtttgtcaatgaagcaaagagacaagtttttggaattgtcgggatagacagtttg
gctggcccttctgaaatagcagtaattgcagatgaaagtgcggataaagatttcgttctt
tacgatttgttaagccaattagaacacggaaaagatagcaaggcatggttattgacgacg
tcaaaagaactagcagattactgtaatagagagggaataacagttatcgtgtgtagctct
cttgaggaatgctgtaagaaagctaatgaaatagctccagaacaccttgagataataact
agagaacccctaaaattggtagacttaattgaaaatgcaggtgcgatatacctagggcta
tacacaccagttcctgcagctgactacttcttaggagttaatcacgttctcccaacggga
ggtgcggcaaaattcatgggtgttctcacagtttgggacttcatgaagccaataagcatt
gcaatggttagtagagaggagtttatctctgaaagagagctgggaataagattagctgaa
atagaaggaatagaactccacaaaaagagcttggaggttagaaaatga

DBGET integrated database retrieval system