KEGG   Pyrococcus furiosus DSM 3638: PF1705Help
Entry
PF1705            CDS       T00075                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PF1705 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PF1705 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PF1705 (trpA)
Enzymes [BR:pfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PF1705 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1583717..1584463)
Genome map
AA seq 248 aa AA seqDB search
MFKDGSLIPYLTAGDPDKQSTLNFLLALDEYAGAIELGIPFSDPIADGKTIQESHYRALK
NGFKLREAFWIVKEFRRHSSTPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVF
HAKEFTEIAREEGIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTTGAREEIPKTAY
DLLRRAKRICRNKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGREATEFLKK
KVEELLGI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaggatggttctctaattccatatttaacagcgggggaccctgataagcagtct
actctcaattttctcctagctcttgatgagtatgctggggcaatagagctgggaattcca
tttagtgatccaatagctgatggtaagacaattcaagagtcgcactacagggcactaaaa
aatggatttaagttgagagaggccttctggattgttaaggaattcagaaggcattccagt
acaccaatagtcctgatgacttactacaatccaatatacagagcaggggttaggaatttt
ctagcagaggcaaaggctagtggtgtcgatggaattctagttgtggaccttccagttttt
catgctaaagagtttacagagattgctagagaagaaggcattaagacagtatttttggcg
gctcccaatactccagatgaaaggctcaaggttattgatgacatgacgactgggtttgtc
tatctagtctccctatatggaacaacaggagctagggaggaaatacccaaaactgcttat
gatttgctcagaagagctaaaaggatatgcagaaacaaggttgctgtgggattcggggtg
tctaaaagggagcacgttgtgagtttacttaaagaaggtgcgaatggagttgttgtggga
agcgctttggtaaaaataataggagaaaagggaagagaggccacagaattcttaaagaag
aaagtagaggaacttttagggatctaa

DBGET integrated database retrieval system