KEGG   Pyrococcus furiosus DSM 3638: PF1706Help
Entry
PF1706            CDS       T00075                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PF1706
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PF1706
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PF1706
Enzymes [BR:pfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PF1706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1584456..1585622)
Genome map
AA seq 388 aa AA seqDB search
MWFGEFGGQYVPETLIEPLKELEKAYKRFKDDEEFNRQLNYYLKTWAGRPTPLYYAKRLT
EKIGGAKIYLKREDLVHGGAHKTNNAIGQALLAKFMGKTRLIAETGAGQHGVATAMAGAL
LGMKVDIYMGAEDVERQKMNVFRMKLLGANVIPVNSGSRTLKDAINEALRDWVATFEYTH
YLIGSVVGPHPYPTIVRDFQSVIGREAKAQILEAEGQLPDVIVACVGGGSNAMGIFYPFV
NDKKVKLVGVEAGGKGLESGKHSASLNAGQVGVFHGMLSYFLQDEEGQIKPTHSIAPGLD
YPGVGPEHAYLKKIQRAEYVTVTDEEALKAFHELSRTEGIIPALESAHAVAYAMKLAKEM
SRDEIIIVNLSGRGDKDLDIVLKVSGNV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtggtttggtgagtttggaggtcaatatgtgcctgagactctaatagaaccattaaaa
gaattagaaaaggcatataaaaggtttaaagacgatgaggagtttaacaggcagttgaat
tattatcttaaaacctgggctggcagaccaactcctctatattatgccaaaagactaact
gaaaagataggtggggcaaaaatatatctaaagagagaagatctagttcacggaggagcc
cacaagacgaacaatgcaatagggcaagctttgttagcgaagtttatgggtaaaactagg
ctaatagctgagaccggagctggtcagcatggtgttgcaacggcaatggctggagcttta
cttggcatgaaggttgatatatacatgggagctgaggacgttgaaagacaaaaaatgaat
gtattcagaatgaaactattgggggcaaatgttattccagtaaattctggttctaggaca
ttaaaggatgcaataaatgaagccctaagggattgggtggccacgtttgaatacactcac
tacttaataggttccgtggttgggccccatccatatccaacaatagttagagactttcag
tccgtaataggaagggaagctaaggcccaaattcttgaggctgaagggcagttgcctgat
gtaatagtggcctgtgttggaggaggaagcaatgcaatggggatattttacccgtttgta
aatgataagaaggttaaacttgtgggagttgaggctgggggtaagggtttggaaagtggg
aaacactcggcatctctgaatgctggtcaagttggagtattccatggaatgcttagctac
ttcttacaggatgaggagggacagataaagcctacacacagcattgctcctggcctcgat
tacccaggagtggggcctgaacatgcatatcttaagaaaatccaaagggctgaatacgtt
actgtaactgacgaagaggcgttgaaagcgtttcacgaactttcaagaactgaaggtata
attcctgctcttgaatcagcacatgcagtagcttatgctatgaagcttgcaaaagaaatg
agtagagacgagataattatagtaaacctatctggaaggggagacaaggatcttgatata
gtcttgaaggtgagtggaaatgtttaa

DBGET integrated database retrieval system