KEGG   Pyrococcus furiosus DSM 3638: PF1861Help
Entry
PF1861            CDS       T00075                                 

Definition
(GenBank) endo-1,4-beta-glucanase-like protein
  KO
K20608  
tetrahedral aminopeptidase [EC:3.4.11.-]
Organism
pfu  Pyrococcus furiosus DSM 3638
Brite
Enzymes [BR:pfu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     PF1861
Peptidases [BR:pfu01002]
 Metallo Peptidases
  Family M42: glutamyl aminopeptidase family
   PF1861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1717470..1718510)
Genome map
AA seq 346 aa AA seqDB search
MVDWELMKKIIESPGVSGYEHLGIRDLVVDILKDVADEVKIDKLGNVIAHFKGSAPKVMV
AAHMDKIGLMVNHIDKDGYLRVVPIGGVLPETLIAQKIRFFTEKGERYGVVGVLPPHLRR
EAKDQGGKIDWDSIIVDVGASSREEAEEMGFRIGTIGEFAPNFTRLSEHRFATPYLDDRI
CLYAMIEAARQLGEHEADIYIVASVQEEIGLRGARVASFAIDPEVGIAMDVTFAKQPNDK
GKIVPELGKGPVMDVGPNINPKLRQFADEVAKKYEIPLQVEPSPRPTGTDANVMQINREG
VATAVLSIPIRYMHSQVELADARDVDNTIKLAKALLEELKPMDFTP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggtagattgggaactaatgaaaaaaataatagaatctccaggagtttctgggtatgaa
cacctgggaattagagaccttgtggtagatattcttaaagatgttgcggatgaagtaaaa
attgataagcttgggaatgtgattgcccactttaagggctctgctcccaaggtaatggtt
gctgctcacatggataagataggactcatggtaaatcatattgacaaagatggctatcta
cgtgttgtcccaattggtggggttttgcctgaaaccttaatagctcagaagataagattc
ttcacagaaaaaggggagagatatggtgttgtaggagttttgcctcctcacttgagaagg
gaagccaaggatcaaggtggtaagatagattgggatagcattatagtggatgttggagct
tctagcagggaagaagctgaagagatgggattcagaattgggacaattggagagtttgca
ccaaacttcacaaggcttagcgagcacaggtttgccaccccctatttggatgataggata
tgcctatatgcgatgattgaagctgctagacaattaggagagcatgaagcagatatatac
attgtagcgtctgtgcaggaggagattgggctcagaggagcgagggtcgcgagctttgct
atagacccagaagttggaattgctatggatgtcacctttgcaaagcaaccaaatgacaaa
ggaaagatagttccagagttgggtaagggtcccgttatggatgttgggccaaatattaat
ccaaaactaaggcagtttgctgacgaggttgcaaagaaatatgagatcccattacaagtt
gaaccaagtccaaggcctactggaactgatgcaaatgtaatgcagataaacagagaaggt
gttgcgacggcagttctcagtataccaatcagatatatgcattcccaggttgaattagct
gatgctagagatgttgacaatacaataaaacttgctaaggcgttacttgaggagctaaag
ccaatggactttacaccgtga

DBGET integrated database retrieval system