KEGG   Pyrococcus furiosus DSM 3638: PF1901Help
Entry
PF1901            CDS       T00075                                 

Definition
oxygen-independent coproporphyrinogen III oxidase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pfu  Pyrococcus furiosus DSM 3638
Brite
Enzymes [BR:pfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PF1901
Transfer RNA biogenesis [BR:pfu03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    PF1901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1750051..1751973
Genome map
AA seq 640 aa AA seqDB search
MHPLLRMIAIIPNINIVFADFIFVCCNLLLIKISNKTNILKAMPEVYEEMSDEAFKAAIE
EIVNALLSGEIKSREELERIKVEVAKKYHLPKFPKNSDIWKALPKDAREKFRDLLKKKPT
RTISGVAVVAMMTKPFPCPHGRCIYCPGGPAVGSPQSYTGKEPSALRASQYAYHPYIIMM
ARLKQLYDIGHPIDKVEVIIQGGTFPATDLDYQEWYIKCAFKAMNDFWYFKDIENLEEKL
VRLILLKDESVLNEDPKFRKAWEKTHKKKFYYLEEEQKKNEKAKVRMVGLTIETRPDWAF
ERQIDRMLAFGTTRVELGVQTIFNFIHERVGRGHGVEEIIKATQLLRDAGLKINYHIMPG
LPGSNFERDLYVFKTIFEDPRFRPDMLKIYPTLVTRDAPLYAWYKAGLYKPYTTEEAVEL
LVEAYKIFPKWVRVMRIQRDIPSHLIVAGVKHSNLGQLVFEELVRRGIRPREIRFREVGH
QMQKFGKMPEIEHIKLLREDYEAGEGTEIFLSFEDVKNDILIGFLRLRIPSEKAHRKEIN
CCPSAIVRELHVYGPMVPIGEKPKYEWQHRGYGRELLAEAERIAREEFDAKKMLIISGVG
VREYYRKFGYRKDGPYVSKRLDKRYADYKRTNRFDAELNT
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgcatccactactaagaatgatagcaataatacccaatataaatatagtttttgctgac
ttcatatttgtttgttgtaatttactacttataaagatttctaataagacaaacatttta
aaggctatgccagaagtgtatgaagaaatgagcgatgaagctttcaaggctgcaatagaa
gaaattgtaaacgcactcctgtctggagagataaagagtagggaagagttagagaggatt
aaggtagaggtggctaaaaagtaccaccttccaaagtttccaaagaactccgacatatgg
aaagcccttcccaaagatgcaagagagaagtttagagaccttctaaaaaagaaacctaca
agaacgataagtggagtagcagtagttgcaatgatgacgaaacccttcccatgcccccat
gggagatgtatttactgcccaggtggaccagcagttggttcacctcaaagttacactgga
aaagaaccctcagctttgagagcctctcaatacgcttatcatccttacataataatgatg
gccaggctaaagcaactctacgatattggccacccaatagataaagtcgaagttataata
caaggcgggacattccctgcaactgatctagactaccaagaatggtacatcaagtgtgcc
tttaaagccatgaatgatttctggtactttaaggacatagaaaacttggaggaaaagcta
gttcgcctaattctgctaaaagatgagtcggttcttaatgaagatccaaagtttaggaaa
gcctgggaaaaaacccacaagaaaaagttctattatttagaggaggagcagaaaaagaac
gaaaaagcaaaagttagaatggttggtttaacaattgagacgaggcccgattgggcattt
gagagacaaattgataggatgttagcttttgggacaactagagtcgagcttggagtacaa
acaattttcaacttcattcatgaaagggtaggaagagggcacggagttgaagaaataatt
aaggctactcaactcctgagggatgctgggttaaagataaattatcacataatgcccgga
ctccctgggagcaactttgaaagggacctttacgtttttaagacgatatttgaagatccg
agatttagacccgacatgttaaagatatatccaaccctcgtaactagagatgctcccctc
tacgcatggtataaggctggtctgtataagccttacactacagaagaggccgtggagtta
cttgttgaggcgtataagatattccccaagtgggttagggtcatgagaatacagagggac
atcccctcccacttaattgttgcgggtgttaagcactcaaatctaggacaacttgtattt
gaggaacttgtaaggaggggaataagacccagggagataaggtttagagaggtaggccat
caaatgcagaagtttggaaagatgcccgaaatagaacacattaaattgcttagagaggat
tatgaagctggggagggaacagagatattcctaagctttgaagatgtgaagaatgacata
ctcataggtttcctaaggctgagaattccgagcgaaaaagcccacagaaaggagataaac
tgctgtccctcagccatagttagggagcttcacgtctacggacccatggttccaataggg
gaaaagccgaagtacgaatggcagcatagagggtatggaagagaactcctagctgaagct
gaaaggatagcaagagaggagtttgatgcaaagaaaatgcttattattagtggagttgga
gttagagagtactacagaaaattcggctatagaaaagatggaccatatgtaagcaagaga
ctcgacaagaggtatgcagattacaagaggacaaataggtttgacgccgagctaaatact
tga

DBGET integrated database retrieval system