KEGG   Pyrococcus furiosus DSM 3638: PF1920Help
Entry
PF1920            CDS       T00075                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
pfu00010  Glycolysis / Gluconeogenesis
pfu00051  Fructose and mannose metabolism
pfu00562  Inositol phosphate metabolism
pfu01100  Metabolic pathways
pfu01110  Biosynthesis of secondary metabolites
pfu01120  Microbial metabolism in diverse environments
pfu01130  Biosynthesis of antibiotics
pfu01200  Carbon metabolism
pfu01230  Biosynthesis of amino acids
Module
pfu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pfu_M00002  Glycolysis, core module involving three-carbon compounds
pfu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PF1920
   00051 Fructose and mannose metabolism
    PF1920
   00562 Inositol phosphate metabolism
    PF1920
Enzymes [BR:pfu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PF1920
Exosome [BR:pfu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PF1920
  Exosomal proteins of bladder cancer cells
   PF1920
  Exosomal proteins of melanoma cells
   PF1920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG FMN_dh IGPS DHO_dh B12-binding His_biosynth NanE RNA_pol_inhib
Motif
Other DBs
NCBI-ProteinID: AAL82044
UniProt: P62002
Position
complement(1771227..1771913)
Genome map
AA seq 228 aa AA seqDB search
MAKLKEPIIAINFKTYIEATGKRALEIAKAAEKVYKETGVTIVVAPQLVDLRMIAESVEI
PVFAQHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEAAIRRAEEVGLMT
MVCSNNPAVSAAVAALNPDYVAVEPPELIGTGIPVSKAKPEVITNTVELVKKVNPEVKVL
CGAGISTGEDVKKAIELGTVGVLLASGVTKAKDPEKAIWDLVSGIIKE
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggctaaactcaaggagccaattatagcaatcaattttaagacgtacatagaggcaact
ggaaaaagggctttagaaatagcaaaggccgctgaaaaagtgtacaaagaaacaggtgta
acaattgtggttgctccccagcttgtagatctaagaatgattgccgaaagcgttgaaata
cctgtattcgctcaacatatagacccgataaaacctgggagtcatactggacacgttctt
cctgaggctgtgaaggaagctggagcggtagggactctcctcaatcactctgagaataga
atgatccttgcagatctcgaggctgcaataaggagggccgaagaagtaggtctaatgaca
atggtctgctctaataatcctgctgtatcggcggctgtagccgctttgaacccagattat
gttgctgtagagcctcctgagttgataggaactggtatcccagtcagtaaggccaagcct
gaagtgataaccaacacagtggagttggttaagaaggtaaatcctgaggttaaggttctt
tgtggagctggaatatccacgggagaagacgttaagaaggcaatagagcttggaacggta
ggggttcttttagcaagtggagtaacaaaagcaaaagatccagagaaggcgatatgggat
cttgtttcgggaataattaaggagtag

DBGET integrated database retrieval system