KEGG   Pyrococcus furiosus DSM 3638: PF1920Help
Entry
PF1920            CDS       T00075                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PF1920
   01230 Biosynthesis of amino acids
    PF1920
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PF1920
   00051 Fructose and mannose metabolism
    PF1920
   00562 Inositol phosphate metabolism
    PF1920
Enzymes [BR:pfu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PF1920
Exosome [BR:pfu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PF1920
  Exosomal proteins of bladder cancer cells
   PF1920
  Exosomal proteins of melanoma cells
   PF1920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1771227..1771913)
Genome map
AA seq 228 aa AA seqDB search
MAKLKEPIIAINFKTYIEATGKRALEIAKAAEKVYKETGVTIVVAPQLVDLRMIAESVEI
PVFAQHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEAAIRRAEEVGLMT
MVCSNNPAVSAAVAALNPDYVAVEPPELIGTGIPVSKAKPEVITNTVELVKKVNPEVKVL
CGAGISTGEDVKKAIELGTVGVLLASGVTKAKDPEKAIWDLVSGIIKE
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggctaaactcaaggagccaattatagcaatcaattttaagacgtacatagaggcaact
ggaaaaagggctttagaaatagcaaaggccgctgaaaaagtgtacaaagaaacaggtgta
acaattgtggttgctccccagcttgtagatctaagaatgattgccgaaagcgttgaaata
cctgtattcgctcaacatatagacccgataaaacctgggagtcatactggacacgttctt
cctgaggctgtgaaggaagctggagcggtagggactctcctcaatcactctgagaataga
atgatccttgcagatctcgaggctgcaataaggagggccgaagaagtaggtctaatgaca
atggtctgctctaataatcctgctgtatcggcggctgtagccgctttgaacccagattat
gttgctgtagagcctcctgagttgataggaactggtatcccagtcagtaaggccaagcct
gaagtgataaccaacacagtggagttggttaagaaggtaaatcctgaggttaaggttctt
tgtggagctggaatatccacgggagaagacgttaagaaggcaatagagcttggaacggta
ggggttcttttagcaagtggagtaacaaaagcaaaagatccagagaaggcgatatgggat
cttgtttcgggaataattaaggagtag

DBGET integrated database retrieval system