KEGG   Pyrococcus furiosus DSM 3638: PF1922Help
Entry
PF1922            CDS       T00075                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pfu  Pyrococcus furiosus DSM 3638
Brite
Enzymes [BR:pfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PF1922 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1772562..1773380)
Genome map
AA seq 272 aa AA seqDB search
MIIESTTTRIKEIRANTFMAPVRIVPFLLEFIKIILEQTKNIVMHLYSSDFPLMMDEKEL
YEKWMRTVEMLKAEGIIRSKEVERAFLKYPRYLFVEDKYKKYAHIDEPLPIPAGQTVSAP
HMVAIMLEIANLKPGMNILEVGTGSGWNAALISEIVKTDVYTIERIPELVEFAKRNLERA
GVKNVHVILGDGSKGFPPKAPYDVIIVTAGAPKIPEPLIEQLKIGGKLIIPVGSYHLWQE
LLEVRKTKDGIKIKNHGGVAFVPLIGEYGWKE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgattatcgaaagcacgactacaaggataaaggagataagggcaaacacttttatggca
cctgtcagaattgtaccttttctgctggaatttataaagattattttggaacaaacaaag
aatatagtaatgcatttatactcttcagattttcctctaatgatggatgagaaagaactt
tacgaaaagtggatgcgaacagtggaaatgttgaaggctgagggaataattagaagtaag
gaagtggagcgagcatttctaaaataccctcgatacttgtttgtggaagataagtacaaa
aaatacgctcacattgatgagcctcttccaattccagcaggccagacagtctcggctcct
catatggtggcaataatgcttgagatcgctaatctaaaacctggaatgaatattcttgaa
gtgggaactggaagtgggtggaatgctgccttgatttctgaaatagtcaaaacggatgta
tacacaatagaaaggatccctgaacttgtggaatttgcaaaaagaaacttggagagagca
ggcgtaaagaatgttcatgtaattttgggagatgggagtaaaggatttcctcccaaggct
ccctatgatgttattatcgtcacagctggtgctccaaagattcccgaaccacttattgaa
cagttaaaaattggtggaaagttgataattcctgtaggtagctatcacctctggcaagag
cttttagaagttaggaaaactaaagatggcattaagatcaaaaaccatggtggggtagcc
ttcgttcctttaataggggaatacgggtggaaagaatga

DBGET integrated database retrieval system