KEGG   Pyrococcus furiosus DSM 3638: PF1957Help
Entry
PF1957            CDS       T00075                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PF1957
Enzymes [BR:pfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PF1957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1807417..1808382
Genome map
AA seq 321 aa AA seqDB search
MKIQRKLLRQKVSFDFSFLLIKFLNSSLARLFGDDMLLHTYKSFDMELPLVNIKDADYVI
LGLPYDGTTSYKPGARFGPVLIRQATLNFESYILDYDVDLAEAKIADAGDVALPVSIEEA
LKVAEETVRELREINPKALPIFLGGEHSMTLAPVRVLKPKSYVVFDAHLDLRDSYGGSKF
NHACVARRINELRVEVAIFGVRSGTKEEVDFARKNGIEWIHARDYSFEAFVDIVSTLPEP
IYLSIDIDTFDASLVPETGTPEPGGLRFWDVVEALEWLSESREVIGIDIMEVGGEKLGNV
TALTGAKLLFYLLGMFEGIKK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccagaggaagctgctaaggcagaaggtctcatttgacttttcttttcttttg
ataaaattcttaaactcttctctagctcgtctttttggtgatgacatgctgttacatacc
tacaaatcatttgatatggaactgccactagtcaacataaaagatgccgactacgtgatt
ctgggccttccctatgatgggactacaagctataagccaggtgcaaggtttggtccagtt
ttaataaggcaagctactctaaattttgagagctacattttggattatgacgttgattta
gccgaagctaagatagctgacgctggagatgtagcactacctgtgagtatagaagaggca
ctaaaggtcgctgaggaaactgtgagagagttgagagaaataaatcccaaagctttgcca
atattcctaggtggagagcattctatgacgctagccccagtaagagtcctcaaacctaag
agttatgtagtctttgatgcgcatttggacttaagagacagctacgggggttcaaagttc
aaccatgcttgtgttgctagaagaataaatgagttgagagtagaagtggcaatatttgga
gtgaggagtgggactaaggaggaggtggattttgcacggaaaaacggaatagagtggatt
catgcaagagactacagctttgaagcgtttgtagatattgttagcactctaccagagccc
atatacctttcaattgacatagataccttcgatgcatctctagttcctgaaactggaacc
ccagagcctggaggattaagattctgggacgttgtggaagctttagaatggttatcagag
agcagggaagtcattgggatagatataatggaagttggaggagaaaagctgggcaatgta
acagccttaactggggcaaagctcctcttctacctcctgggaatgttcgaggggattaag
aaatga

DBGET integrated database retrieval system