KEGG   Pyrococcus furiosus DSM 3638: PF1961Help
Entry
PF1961            CDS       T00075                                 

Definition
tungsten-containing formaldehyde ferredoxin oxidoreductase wor4
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PF1961
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PF1961
Enzymes [BR:pfu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     PF1961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1811080..1812948
Genome map
AA seq 622 aa AA seqDB search
MFGYKGKIARVNLTTGKVKYEDLPEEIIRKFIGGKGLGYYIIYKEVPPGTDPLSPANKFV
FATGGLTGLVPGGSKVIAVSKSPTTRLITDSSGGDAFGPKLKGHFDALIIEGRSEEPVYL
YIHDGKVEINPAEHLWGKGTYEVAKEIWKDHPSASIAMIGPAGEKMSRMANVVYDTERAS
GRGGLGAVLGSKRVKAIVVEPGERPKVAHTEEFQQLWSEFYKKFSTDPKYADTRKYGTTT
ALLWAAEVGMGSAYNFSKPHIPEELAKKLSGLEIERYEIEPEWYIHGKSCPIKCSMYMEI
EYKGKKIRVKPEYESLGMLGAATGVFDLPAVSYFIWLVNNYGLDSIATGNTIAWFLELVE
RGLITEEEIGFPVKGFGDAEAVERLIHLIAERKGIGAVLADGVKRACERLGRGCEFAVHV
KGLESPAWDPRGRRTYALSYATADIGASHLRGWPSPHQLPNDGPAKELVPSLIEDRDYMY
IINMLGVCKFVPYTLDDLAKLYSLATGEEWSVEKLRRVAQAVESMARIYNALEWITPPLD
DTIPPRWWEPEKDGPAKGNAAFIDYNDFLEARREFYRLRGWDEELGVPLPETMEKLGYPE
FKEDAKRALEVVKRRMLNTALS
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggtataagggaaaaattgcaagggttaacctcacaactgggaaagttaagtat
gaagaccttccagaagagataatcaggaagtttataggtggaaaagggcttggatattac
attatctacaaggaagttcctcctgggacagaccccctaagccccgcaaataagtttgta
tttgcaactggagggttaacaggcctagtcccagggggaagcaaggtaattgcagtctca
aagagcccaaccactaggcttatcacagattccagtggaggagatgcttttggcccaaag
ctcaaggggcattttgatgccctaataatagagggaagatctgaagagcccgtctatcta
tacattcacgacggaaaagttgaaataaacccagctgagcacctatggggtaagggcact
tatgaagtggcaaaagaaatctggaaagatcatccaagtgctagcatagcaatgatagga
ccagcaggagagaagatgagtagaatggcaaatgttgtttacgacaccgagagggccagc
ggaaggggaggactcggcgcagtgctcggaagcaagagagttaaagctatcgtggtagag
cctggggagagaccaaaagtcgctcatactgaagagttccaacaactgtggagtgagttt
tacaaaaagttctctactgatccaaagtacgctgacactagaaaatacggaactacaact
gctctcctgtgggcagctgaagttggaatgggttcagcttataatttctccaaaccgcac
attcctgaagagctggctaagaagctttcgggcctcgaaatcgagagatatgagatagag
cctgaatggtatatccacggaaagagctgccccataaagtgcagcatgtatatggaaatt
gagtacaaagggaagaagataagagttaagcccgaatatgaaagtttgggaatgctcgga
gctgccacgggagtatttgacttgccagcagtttcttacttcatttggctggttaacaac
tatggactcgacagcatagctactggaaataccattgcatggttcttagaactggttgag
agaggactcattacagaggaagaaattggatttccagtaaagggatttggagatgcagag
gcagtggaaaggctaattcacctaatagcggagagaaagggaataggcgcagttttagct
gacggtgttaagagagcctgcgaaagattaggaagaggatgcgaattcgctgttcatgtt
aaaggattggaatcccctgcctgggatcccaggggaaggagaacctacgcgttaagctat
gctacagctgacattggtgcttcccacttgaggggatggccaagccctcaccaattgcca
aacgatggaccagcgaaggagttagtcccatcgctcattgaggacagagactacatgtac
attataaacatgctaggtgtgtgcaagttcgtcccgtacacgcttgacgatttggctaag
ctatattccctagctactggagaagaatggtcagtggagaagctaaggagagttgcgcag
gctgtagagagcatggcaagaatttacaatgcactcgagtggattacaccaccattagat
gatacaataccaccacgctggtgggagccagaaaaagatggtccagcaaagggaaacgca
gcattcattgattacaacgacttcttggaggcaaggagagagttctacaggctaagggga
tgggatgaagagttgggcgttccactaccagaaacaatggagaaacttggatacccagag
ttcaaggaagatgcaaagagagcattggaagtagttaagaggagaatgctcaatactgct
ctctcatag

DBGET integrated database retrieval system