KEGG   Pyrococcus furiosus DSM 3638: PF2004Help
Entry
PF2004            CDS       T00075                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PF2004 (glpK)
Enzymes [BR:pfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PF2004 (glpK)
Exosome [BR:pfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PF2004 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1852917..1854389
Genome map
AA seq 490 aa AA seqDB search
MDRYILSLDEGTTSARAIIFDKNSNVLGIGQYEFPQYYPKPGWVEHNPEEIWEAQVKAIK
TAIEKAKIEANQIAAIGVTNQRETTVIWKKDGKPVYNAIVWQCRRTAEMVEEIKREYSDV
IKEKTGLVPDAYFSASKIAWLLDNVPGLREKAEKGEVMFGTIDTFLIYRLTGEHVTDYSN
ASRTMLFNINKLEWDEELLEIFKIPDGILPDVKESSEIYGYTKILGPEIPVSGDAGDQQA
ALFGQAAFEEGMVKATYGTGNFILANTGRMLLYSDNLLTTVAWGINGKVNYALEGSIFIT
GAAVQWLRDGIKIISNAAETEELATKLESNEGVYFVPAFVGLGAPYWDQFARGLIIGITR
GTGREHLARATLEAIAYLTRDVIEEMEKLIQIKELRVDGGATVNNFLMQFQADILNKKVI
RPVVKETTALGAAYLAGLAVDYWESMEEISQLWRAERVFEPQMDEKTREKLYRGWKEAVK
RALGWAKVVS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaccgctatatcctctctttagatgagggcacaacttccgccagggcaataatattt
gataagaacagcaatgttctaggaattgggcagtatgaattccctcaatactatcccaag
ccagggtgggtagagcataatccagaggaaatttgggaggctcaagtgaaagcaataaag
actgcgatagagaaagccaagatagaggcaaatcaaatagctgctattggagtcacaaac
cagcgtgaaactacagttatttggaaaaaagatgggaaacccgtttacaatgccattgtg
tggcagtgcagaagaactgctgaaatggttgaggaaattaagagagaatatagtgatgtc
attaaagaaaagacaggtcttgttccagatgcctacttttcagcctcaaagatagcatgg
ctcttggacaatgtccctgggcttagagaaaaagcggaaaaaggagaggttatgttcggt
acaattgacacctttctaatttacaggcttacgggagagcacgtaacggactattcaaat
gcctccagaacaatgttgttcaacattaataagctggagtgggatgaagagcttttagag
atctttaagattcccgatggaattttacctgatgtaaaagaatctagtgaaatctatggc
tatacaaaaattcttggcccagaaattccagttagtggggatgctggagatcaacaggct
gctctctttggccaagcagcatttgaagagggaatggtaaaggccacttacgggactgga
aacttcatattggcgaatacaggaagaatgcttctttattcagataacctcctcacaacg
gttgcatgggggattaatgggaaggtaaattatgccctggaaggcagtatcttcatcacg
ggagcagctgttcagtggttgagagacgggattaagataatcagcaatgccgctgagact
gaagaattagctactaagttagagagcaacgagggagtctacttcgttccagcatttgta
ggattgggagctccctactgggatcagttcgctagggggttgataattggaataacaagg
ggaactgggagagaacatcttgcaagggcaaccttagaggccatagcttacctcacaagg
gatgtaattgaagagatggaaaagctgatacagataaaggagcttcgcgtggatggtgga
gccactgttaacaacttcctcatgcagttccaggctgatatcctcaataagaaagttatt
agacctgtagttaaagagaccactgcccttggagctgcctacttagctggtttggccgta
gactattgggaaagcatggaggagatatcacaactctggagagctgagagagtatttgaa
cctcagatggatgaaaaaactagagaaaaactatataggggatggaaagaggccgttaag
agagctttaggttgggccaaagttgtgagttga

DBGET integrated database retrieval system