KEGG   Pyrococcus furiosus DSM 3638: PF2048Help
Entry
PF2048            CDS       T00075                                 

Definition
peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pfu01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pfu00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1889624..1890964
Genome map
AA seq 446 aa AA seqDB search
MRSASPEGMDMDVLELLSQLVEFETVNDPAKGIKPTKECPKFIKDTLEEWEVEADVFEEN
GYYGVLGEIGKGYPKLLFMAHFDVVPVNPEEWNTDPFKLTIIGNKAYGRGSVDDKGNVAA
VMVALKELAKEDIKGKIIFAFTGDEEIGGFLASKIAERLKEENKLPKYMINADGIGMKPI
IRRRKGFGAVIRVPIKKIKVKGKIKSKTFKVNTPILETRHAAYFLPGVDTHPLIAASHFV
RTKEVPVVSLEGKFLKGNVVPSEVTLTYLERGDGEEVEVDLGLTELMRSIVPVVRAPIKA
EKYSDYGVSITPNMYSIENEKHVLRLDIRAMSNSKEDIEKTLKEVISFTLPEGELEVKTN
EKAGYLFTSPEEKIVKVALEVLRELGEDVKPVEGPGASDSRYFTPYGVKAIDIGPKGGNI
HGPNEFVEIDSLKKMPKVYKEIALRL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaggtccgcatcacctgaggggatggatatggacgtgcttgaacttctttctcaattg
gttgagttcgaaaccgttaatgatccagcaaagggaataaaacccaccaaagaatgtccc
aagttcatcaaagatacgctggaagagtgggaagttgaagctgacgtttttgaagagaac
ggctattatggagtattaggggaaattggaaaaggttatccaaagctcctcttcatggct
cacttcgacgtagtcccagtaaatccagaagagtggaacacagatccattcaaattaacc
ataataggaaacaaagcgtatggaaggggaagcgttgatgataaagggaatgttgctgcg
gtgatggtagcactaaaagagcttgcaaaagaagatatcaaaggaaaaataatctttgcc
tttactggagatgaagaaattggaggattcctcgctagcaagattgctgagagattaaaa
gaagagaacaagctaccaaagtacatgatcaatgcagacggaataggaatgaaaccaata
attaggagaagaaaggggtttggagcggttattagagttccgattaagaagatcaaggtt
aaagggaaaataaaatccaaaacattcaaggtaaacaccccaattttagaaacaagacat
gctgcatattttctcccaggagtagacactcatccactaatagcagcttcacacttcgta
agaacaaaagaagtccctgtagtttcccttgaggggaaattcttgaaaggtaacgttgtt
cccagtgaagttactttaacttaccttgaaagaggagatggagaagaagttgaagtggac
cttggattgacagagctgatgaggtcaatagttccagttgtgagggctccaataaaggcg
gaaaaatacagcgactatggagtgtcaataacgccaaacatgtattccatcgaaaacgaa
aaacacgttttaaggctcgatataagggcgatgagtaattcaaaagaagatatcgaaaag
acattaaaagaagttatctcgttcactttgccagagggagaactcgaagtcaaaactaac
gaaaaagcaggttatctcttcacaagtcctgaagaaaagatcgtgaaagttgcattggaa
gttctcagagagcttggcgaagatgttaaaccagttgagggtcctggagcctcagattca
aggtacttcaccccatatggcgtaaaggcaatagatatcgggcctaaaggaggaaatatc
cacggacctaatgaattcgttgaaatagactccctaaaaaagatgccaaaagtgtataag
gaaattgcactaaggctttga

DBGET integrated database retrieval system