KEGG   Pyrococcus furiosus DSM 3638: PF2048Help
Entry
PF2048            CDS       T00075                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
pfu00300  Lysine biosynthesis
pfu01100  Metabolic pathways
pfu01120  Microbial metabolism in diverse environments
pfu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    PF2048
Enzymes [BR:pfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PF2048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: AAL82172
UniProt: Q8TZE7
Position
1889624..1890964
Genome map
AA seq 446 aa AA seqDB search
MRSASPEGMDMDVLELLSQLVEFETVNDPAKGIKPTKECPKFIKDTLEEWEVEADVFEEN
GYYGVLGEIGKGYPKLLFMAHFDVVPVNPEEWNTDPFKLTIIGNKAYGRGSVDDKGNVAA
VMVALKELAKEDIKGKIIFAFTGDEEIGGFLASKIAERLKEENKLPKYMINADGIGMKPI
IRRRKGFGAVIRVPIKKIKVKGKIKSKTFKVNTPILETRHAAYFLPGVDTHPLIAASHFV
RTKEVPVVSLEGKFLKGNVVPSEVTLTYLERGDGEEVEVDLGLTELMRSIVPVVRAPIKA
EKYSDYGVSITPNMYSIENEKHVLRLDIRAMSNSKEDIEKTLKEVISFTLPEGELEVKTN
EKAGYLFTSPEEKIVKVALEVLRELGEDVKPVEGPGASDSRYFTPYGVKAIDIGPKGGNI
HGPNEFVEIDSLKKMPKVYKEIALRL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaggtccgcatcacctgaggggatggatatggacgtgcttgaacttctttctcaattg
gttgagttcgaaaccgttaatgatccagcaaagggaataaaacccaccaaagaatgtccc
aagttcatcaaagatacgctggaagagtgggaagttgaagctgacgtttttgaagagaac
ggctattatggagtattaggggaaattggaaaaggttatccaaagctcctcttcatggct
cacttcgacgtagtcccagtaaatccagaagagtggaacacagatccattcaaattaacc
ataataggaaacaaagcgtatggaaggggaagcgttgatgataaagggaatgttgctgcg
gtgatggtagcactaaaagagcttgcaaaagaagatatcaaaggaaaaataatctttgcc
tttactggagatgaagaaattggaggattcctcgctagcaagattgctgagagattaaaa
gaagagaacaagctaccaaagtacatgatcaatgcagacggaataggaatgaaaccaata
attaggagaagaaaggggtttggagcggttattagagttccgattaagaagatcaaggtt
aaagggaaaataaaatccaaaacattcaaggtaaacaccccaattttagaaacaagacat
gctgcatattttctcccaggagtagacactcatccactaatagcagcttcacacttcgta
agaacaaaagaagtccctgtagtttcccttgaggggaaattcttgaaaggtaacgttgtt
cccagtgaagttactttaacttaccttgaaagaggagatggagaagaagttgaagtggac
cttggattgacagagctgatgaggtcaatagttccagttgtgagggctccaataaaggcg
gaaaaatacagcgactatggagtgtcaataacgccaaacatgtattccatcgaaaacgaa
aaacacgttttaaggctcgatataagggcgatgagtaattcaaaagaagatatcgaaaag
acattaaaagaagttatctcgttcactttgccagagggagaactcgaagtcaaaactaac
gaaaaagcaggttatctcttcacaagtcctgaagaaaagatcgtgaaagttgcattggaa
gttctcagagagcttggcgaagatgttaaaccagttgagggtcctggagcctcagattca
aggtacttcaccccatatggcgtaaaggcaatagatatcgggcctaaaggaggaaatatc
cacggacctaatgaattcgttgaaatagactccctaaaaaagatgccaaaagtgtataag
gaaattgcactaaggctttga

DBGET integrated database retrieval system