KEGG   Pseudomonas fulva: Psefu_0128Help
Entry
Psefu_0128        CDS       T01501                                 

Definition
aldose-1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pfv  Pseudomonas fulva
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psefu_0128
   00052 Galactose metabolism
    Psefu_0128
Enzymes [BR:pfv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Psefu_0128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(148522..149667)
Genome map
AA seq 381 aa AA seqDB search
MTHPHHLLSGLALSLAIATGANAAGLTSEHKPFGKTRDGTPVEQYQLRNSHGMQATIITY
GGVLQALAVPDKNGKVEDVVLGFDDVQGYEGGTAFFGATIGRFGNRLAGGAFELDGKRFQ
VPLNDGPNALHGGAEGFDKKVWEAKPVKDKDSVGVTLTYLSKDGEMGFPGNLKTEVTYRL
TDNNELHIDYKATTDKPTVVNLTNHSYFNLAGAGNGDILKQVATLHASHYTPVNKTLIPT
GELAPVKGTPMDFSKPTPIGQHIKDDHEQLKFAEAKQGGFDFNWALDTKGDIKQLAAEVH
DPASGRLLQLYTTEPGVQFYTSNFLDGSVKGKAGKTYAHWGAFTLETQHFPDAPNQPKFA
STRLDPGQTYTQNTVFKFSVK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgacccaccctcaccacctgctatccggcctggctctttctctggcgattgccacaggc
gccaacgcggcagggttgaccagtgaacacaagccattcggcaagacccgcgacggcacg
cccgtcgagcagtaccagttgcgcaacagccatggcatgcaggccaccatcatcacttac
ggcggcgtgctgcaggccctggcagtgccggacaagaacggcaaggtagaagacgtggtg
ctgggtttcgatgacgtgcagggctacgaaggcggtactgcattcttcggcgccaccatc
ggccgcttcggcaatcgcctggccggcggcgccttcgagctcgatggcaagcgctttcag
gtaccgctcaacgacgggccgaacgccctgcacggcggcgccgagggcttcgacaagaag
gtctgggaagccaagccggtgaaggacaaggattcggtcggcgtaaccctcacctacctg
tccaaggacggcgagatgggctttcccggcaatctgaaaaccgaagtcacctaccgcctc
accgataacaacgaactgcacatcgactacaaggccaccaccgacaagcccaccgtggtc
aacctcaccaaccacagctacttcaacctcgccggtgccggcaacggcgatatcctcaag
caggtcgccaccctgcacgccagccactacacgccggtcaacaagacgctgatccccact
ggcgaactggccccggtcaaaggcacgccgatggacttcagcaaaccgacgcccatcggc
cagcacatcaaggatgaccacgagcagctcaagttcgccgaggccaaacagggcggcttc
gacttcaactgggcgctggataccaaaggcgacatcaagcaactcgccgccgaagtccac
gaccccgcctccggccgcctcctgcagctctacaccaccgagccgggcgtgcagttctac
accagcaacttcctggacggctcggtaaaaggcaaagccggcaagacctacgcccactgg
ggcgccttcaccctggaaacccagcacttcccggatgcaccgaaccagccgaagttcgcg
tctacccgcctggatccggggcagacctatacgcagaacacggtgttcaagttttcggtg
aagtag

DBGET integrated database retrieval system