KEGG   Pseudomonas fulva: Psefu_0144Help
Entry
Psefu_0144        CDS       T01501                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pfv  Pseudomonas fulva
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Psefu_0144
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psefu_0144
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Psefu_0144
Enzymes [BR:pfv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Psefu_0144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(166584..167393)
Genome map
AA seq 269 aa AA seqDB search
MSRLQTRFAELKEQNRAALVTFVTAGDPNYEASLKILKGLPKAGADVIELGMPFTDPMAD
GPAIQLANIRALAAKQNLAKTLQMVREFRQDDSTTPLVLMGYFNPIHKYGVERFIADAQE
AGVDGLIVVDLPPEHNRDLCDPAQAAGIDFIRLTTPTTDDKRLPTVLAGSSGFVYYVSVA
GVTGAGSATVEHVQEAVTRLRRHTDLPISIGFGIRTPEHAATIARLADGVVVGSALIDQI
AKADNDQQAIDGVLSLCSQLAEGVRSARR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgcagacgcgcttcgccgagctgaaagaacagaaccgcgccgccctggtg
accttcgtcaccgctggcgacccgaactacgaggcttcgctgaagatcctcaagggcctg
ccgaaagccggtgccgacgtgatcgagctgggcatgccgttcaccgacccgatggccgat
ggcccggcgatccagctggccaacatccgcgccctggccgccaagcagaacctggccaag
acgctgcagatggtccgtgaattccgccaggacgacagcaccacgccgctggtgctgatg
ggttacttcaacccgatccacaagtacggcgtcgagcgcttcatcgccgatgcccaggag
gccggcgtcgacggcctgatcgtggttgacctgccgccggaacataaccgcgacctgtgc
gacccggcccaggccgcggggatcgacttcatccgcctgactaccccgaccaccgacgac
aagcgcctgccgaccgtactcgccggcagctcgggcttcgtctactacgtgtcggtggcg
ggtgttaccggcgctggctcggcgaccgtggaacacgtgcaggaagcggtcacccgcctg
cgccgccacaccgacctgccgatcagtatcggcttcggcatccgcaccccggaacatgcg
gcgaccatcgcccgcctggccgacggcgtagtggttggctcggcgctgatcgaccagatc
gcaaaggctgacaatgatcagcaggccatcgacggtgtgctcagcctgtgcagccaactg
gccgaaggtgtgcgcagcgctcgccgctaa

DBGET integrated database retrieval system