KEGG   Pseudomonas fulva: Psefu_0269Help
Entry
Psefu_0269        CDS       T01501                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
pfv  Pseudomonas fulva
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
307466..309514
Genome map
AA seq 682 aa AA seqDB search
MADDAKRWREKYLANIEQQEKLERRWDMRVDLLRRGLVRSSLAAEGSDKSVDQCMQDLRE
ILRRDDMDAGLSALIPRLEKTVLDSEQRRQQRIEQVASGMASLVAQLLKTDLPSDVRKPL
KRFAKQVEQRARQSREMPALLAELGQLQQQALQALGGEQVERPGFIERLFGSRDSASPAA
NAESAASTGPVEPSQHTAPTSDEDESAEQSVAERVTTEPQAQAVTTPVEAAPVVIAEAAS
PSPSPSPEASPQPAIQPTPVAASAPAVVSRVMLDSLPLSSALLMPSPEAKAAAEPANESV
AVAEPIEEAALESVVVNAAVPADPDYALPPAPEPGYSAIASHVEGSLLKLLEELPLPERH
QGQADALRQRIAAGLNMYELVPVLDDLAVLMLAIADVGQREFEGYLKQLNERLAAFQGSL
HDVHSDYTDSAEAARSLDNELRQQVDGLHSSVQEATDLNNLKELVESRLSGLLGTMSQYQ
QQRDAREQQVGERLQILVDRVASMEVEAKGFRDHLEEQRQKALLDPLTGLPNRAAWTERL
DLELARLQRYGGDLLLAVLDIDHFKRINDDYGHLAGDKVLKIIAGELFKRLRKTDFIARF
GGEEFVLLIPSTPMEGGLKLLDTLRSAIENCPFHFKGERVTITLSGGISAFSSAERSEQV
FERADQALYRAKRGGRNRIEVG
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgacgccaaacgctggcgcgagaagtaccttgccaatatcgagcagcaggaa
aagctcgagcgccgctgggacatgcgtgtcgacctgctgcgccgtggcctcgtgcgcagc
agcctggcggccgagggctccgacaagtcggttgaccagtgcatgcaggatcttcgcgag
atcctgcgccgcgacgacatggatgccggcctcagcgcgctgatcccgcgcctggaaaag
accgttctggattccgagcagcgccgccagcagcgtatcgaacaggtcgccagtggcatg
gcgagcctggtggcgcagctgttgaaaaccgacctgccgagcgacgtgcgcaagccactc
aagcgctttgccaagcaggtcgagcagcgcgcccgacagtcgcgggaaatgccggcgctg
ctggccgaactcggccagctgcagcagcaggccttgcaggcactgggcggcgagcaggtc
gaacgcccgggctttatcgagcggctgttcggcagccgcgatagcgccagcccggcagcc
aatgctgagtctgctgcttccactgggccggttgagcctagccaacacaccgcgcctacc
tccgatgaggacgaatctgccgagcagtcggtcgccgagcgggtgacgactgagccgcaa
gcgcaagccgtaacgactccagtagaggcggcgcctgttgttatcgccgaagctgcatcg
ccgtcgccgtcgccgtcgccagaagcctccccgcagcccgccattcagcccacccccgtc
gctgccagcgcgcctgctgtggtgagccgcgtgatgctggacagcctgccgctgtcgtcc
gccttgctgatgccgtcgcccgaggccaaggcggctgccgagccggccaacgagagcgtc
gccgtagcggagcctatcgaggaagcggcgctcgagtccgtcgtcgtcaatgcggcagta
ccggctgatcccgactatgcgttgccgccggcgcccgaaccaggctacagcgccatcgcc
agtcatgtggaaggcagcctgctgaagcttctggaagagttgccactgcccgagcggcat
cagggccaggccgatgcgctgcgccagcgcatcgccgcgggcctgaacatgtacgagctg
gtgccggtactcgatgacctggcggtgctgatgctggccatcgccgatgtcggccagcgc
gagttcgagggctacctcaagcagctcaacgagcgcctcgccgccttccagggcagcctg
cacgatgtgcacagcgactacaccgactccgccgaggccgcgcgcagcctggacaacgag
ctgcgccagcaggtcgacggtctgcacagcagcgtgcaggaggccaccgacctcaacaac
ctcaaggagctggtggagagtcgcctcagcgggctgctcggcaccatgagccagtaccag
cagcagcgcgatgcccgcgagcagcaagtcggcgagcgcctgcagattctggtcgaccgg
gtggccagcatggaagtggaggccaagggctttcgcgatcacctcgaggagcaacgccag
aaggcgctgctcgatccgcttaccggcctgcccaatcgcgcggcctggaccgagcgcctg
gatctggagctggcgcgcctgcagcgttacggcggcgacctgctgctggcggtgctggat
atcgaccacttcaagcgcatcaacgacgactacggccacctggccggtgacaaggtgttg
aagatcatcgccggggagctgttcaagcggctgcgcaagaccgacttcatcgcccgcttc
ggcggcgaggagttcgtgctgctgattccgtccacgcccatggagggcggcctgaagctg
ctcgacacgttgcgttcggccatcgagaactgtccgttccacttcaagggcgagcgggtg
accatcaccctgtccggcggcatcagcgcgttcagcagcgccgagcgcagcgagcaggtg
ttcgagcgtgctgaccaggcgctataccgtgccaagcgcggcgggcgcaaccgtatcgag
gtgggttga

DBGET integrated database retrieval system