KEGG   Pseudomonas fulva: Psefu_0532Help
Entry
Psefu_0532        CDS       T01501                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pfv  Pseudomonas fulva
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Psefu_0532
   00630 Glyoxylate and dicarboxylate metabolism
    Psefu_0532
   00640 Propanoate metabolism
    Psefu_0532
   00650 Butanoate metabolism
    Psefu_0532
  Lipid metabolism
   00071 Fatty acid degradation
    Psefu_0532
   00072 Synthesis and degradation of ketone bodies
    Psefu_0532
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Psefu_0532
   00310 Lysine degradation
    Psefu_0532
   00380 Tryptophan metabolism
    Psefu_0532
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Psefu_0532
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Psefu_0532
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Psefu_0532
Enzymes [BR:pfv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Psefu_0532
Exosome [BR:pfv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Psefu_0532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
590990..592267
Genome map
AA seq 425 aa AA seqDB search
MSLPRRVAIVGGNRIPFARSNSAYATASNQAMLTSALEGLVERYNLHGERLGEVVAGAVL
KHSRDFNLTRECVLGSRLAPQTPAYDLQQACGTGLEAALLVANKIALGQIECGIAGGVDT
TSDAPIGVNEGLRKILLQANRAKSTGDKLKTLLQIRPRHLAPSLPRNGEPRTGLSMGQHC
ELMAQHWAIPRDEQDLLAVESHRKLAAAYAEGWQDDLMTPFLGLTRDQNLRPDIDLTKLA
TLKPVFEKGQRGTLTAANSTPLTDGASLVLLASEEWAKARGLPILAYWRDGEAAAVDFVK
GHEGLLMAPVYAVPRLLARNGLTLQDFDYYEIHEAFAAQVLCTLKAWEDVDYCRERLGLA
QPLGSIDRTKLNVKGSSLAAGHPFAATGGRIVANLAKLLSVAGKGRGLISICAAGGQGVT
AILER
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgccgcgccgggtcgccatcgttggtggcaaccgcattcctttcgctcgttcc
aatagtgcttacgccaccgccagcaaccaggccatgctcaccagcgccctggaggggctg
gtcgagcgctacaacctgcatggcgagcgccttggcgaggtggtggccggcgccgtgctc
aagcactcgcgggatttcaacctgacccgcgaatgcgtgcttggctcgcgcctggcaccg
caaacccccgcctatgatctgcagcaggcctgtggcaccggactggaggccgccctgctg
gtggccaacaagatcgccttggggcagatcgaatgcggtatcgccggcggcgtggatacc
acttcagatgcgccgatcggcgtcaacgaaggcctgcgcaagatcctgttacaagccaac
cgcgccaagagtaccggcgacaagcttaaaaccctgctgcagatccgcccgcggcacctg
gcgccgtcgctgccgcgcaatggcgagccgcgcaccggcctgtccatgggccagcactgc
gagctgatggcgcagcactgggccattccccgtgacgaacaggacctgctggccgtggaa
agccatcgtaagctggctgccgcttacgccgagggctggcaggacgatctgatgacgccg
ttcctgggcctgacccgcgaccagaacctgcgccccgatatcgacctgaccaaactggcg
accctcaagccggtattcgagaaaggccagcgtggcaccctgaccgctgccaactccacg
cccctgaccgacggggcttcactggtgctgctcgctagcgaggagtgggccaaggcccgc
ggcctgccgattcttgcctactggcgggacggcgaggcggcggctgtggatttcgtcaaa
ggccacgaagggctgctgatggcgccggtgtatgccgtaccccggttgctggcgcgcaac
ggcctgaccctgcaggatttcgactactacgaaatccacgaggccttcgccgcacaggtg
ctgtgcaccctcaaggcctgggaagacgtcgactattgccgcgagcgccttggcctggcg
cagccgttgggcagcatcgaccgcaccaaactcaacgtcaaaggcagctccctggcggcc
ggtcacccgttcgccgcgacgggcgggcgtatcgtcgccaacctggccaagctgctgtcg
gtggcgggtaaggggcgcggcctgatttccatctgcgccgcgggcgggcagggcgtgacg
gcgattctggaacgctga

DBGET integrated database retrieval system