KEGG   Pseudomonas fulva: Psefu_0575Help
Entry
Psefu_0575        CDS       T01501                                 

Definition
chemotaxis protein CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pfv  Pseudomonas fulva
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pfv02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pfv02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
643712..644287
Genome map
AA seq 191 aa AA seqDB search
MSGLSAVVVGASAGGVEALLSLFTELPGDYGLPVVVVLHLPDGRESLLPDLFARRLALRV
KEAQDKEALQPGTLYFAAPGYHLCIEADGSFSYSREEPVHFSRPSIDYLFESAADVYGSQ
LLGILLTGANQDGAAGLYTIKQRGGVTVVQDPQEAQVATMPEAALALHQPDYILPLRGIL
ALLTELDSRPC
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggttatcagccgttgtagtcggcgcctcggccggtggcgtggaagcgttgctc
agcctgttcaccgagctaccaggcgactacggtttaccggtggtggtggtgctgcacctg
cccgacgggcgtgaaagcctgctgccggatctgttcgcccgccgcctggcgctgcgggtc
aaggaagcgcaggacaaggaagcgctgcagccgggtacgctgtacttcgccgcgcccggt
tatcacctgtgcatcgaggccgatggcagcttttcctatagtcgtgaggagccggtgcat
ttttcccggccctcgatcgactacctgttcgaatcggctgccgatgtttacggcagccag
ctactgggtatcttgctcacgggcgccaaccaggatggcgccgccgggttgtacacaata
aaacagcggggcggagtgaccgtggtgcaggatccgcaggaggcgcaggttgcgaccatg
cccgaagcggctctggcgctgcaccaacccgactacattcttcctttgcggggcattctc
gcattgctaaccgaactggactcacgcccatgttga

DBGET integrated database retrieval system